close all open/close all

CDS information : Herb_00070


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction9,207 / 8,437 / - [in whole cluster]
9,207 / 8,437 / - [in contig]
Locationcomplement(8437..9207) [in whole cluster]
complement(8437..9207) [in contig]
TypeCDS
Length771 bp (256 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF7p; ORF7; similar to FtrE and Streptomyces coelicolor SC00998 permease (Fe)
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Family/Domain
FD
IPR003593, IPR003439

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding protein [unknown]
MRIDIEDLRVAYAGRTVVADAHLIAAEGEITGLVGPNGSGKSTLLRTVYRHLKPAAGRVL
LDGSDIRELSPARSARHIAALPQERGGDFELTVREVVAMGRTPYKRAFAGEDAADRDIVA
GALADVGMGDHTDRHFSELSGGERQRVLLARAFAQQTDVLVLDEPTNHLDVRHQVELLAL
LRGRRRTTLVSLHDLNAAASVCDRLHVLHEGRVVASGTPREVLRPPLLAEVFGVRAAVVE
HPLTGDPLIAFDHREL
selected fasta
>putative ABC transporter ATP-binding protein [unknown]
TTGAGGATCGATATCGAGGACCTGCGGGTCGCGTACGCCGGACGTACGGTCGTGGCCGAT
GCCCACCTCATCGCGGCCGAAGGCGAGATCACCGGTCTGGTGGGGCCCAACGGCAGTGGC
AAGTCCACTCTTCTGCGGACCGTGTACCGGCATCTGAAGCCCGCCGCCGGACGTGTGCTG
CTCGACGGCTCCGACATCCGCGAGCTGAGCCCCGCGCGGTCGGCCCGGCACATCGCCGCG
CTCCCACAGGAGCGGGGCGGGGACTTCGAGCTGACCGTACGTGAGGTGGTCGCCATGGGC
CGCACCCCCTACAAGCGGGCGTTCGCCGGGGAGGACGCCGCCGACCGGGACATCGTCGCG
GGTGCTCTCGCGGACGTCGGCATGGGGGACCACACCGACCGCCACTTCAGCGAGCTGTCC
GGCGGCGAGCGGCAACGTGTGTTGCTGGCCCGTGCGTTCGCCCAGCAGACGGACGTCCTG
GTCCTGGACGAGCCGACGAACCACCTCGACGTACGCCACCAGGTCGAACTCCTCGCCCTG
CTGCGCGGCCGACGCCGTACGACCCTGGTGTCGCTGCATGACCTCAACGCCGCCGCCTCC
GTGTGCGACCGGCTGCATGTCCTGCACGAGGGTCGCGTGGTCGCCTCCGGTACACCCCGC
GAGGTGCTGCGACCGCCCCTGCTGGCCGAGGTGTTCGGCGTACGTGCGGCCGTGGTCGAG
CATCCGCTGACCGGGGACCCGCTGATCGCCTTCGACCACCGGGAACTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [3-235]  PS50893
PS50893   ABC_TRANSPORTER_2
 [42-167]  5.90000000000001e-23 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [27-243]  5.20000089003336e-21 SM00382
SM00382   AAA
IPR017871 ABC transporter, conserved site (Conserved_site)
 [139-153]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP No significant hit
TMHMM No significant hit