close all open/close all

CDS information : Herb_00080


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction10,286 / 9,204 / - [in whole cluster]
10,286 / 9,204 / - [in contig]
Locationcomplement(9204..10286) [in whole cluster]
complement(9204..10286) [in contig]
TypeCDS
Length1,083 bp (360 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter permease protein
Product (GenBank)FtrD
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF8p; ORF8; similar to Streptomyces coelicolor SC00997
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Family/Domain
FD
IPR000522

close this sectionSequence

selected fasta
>putative ABC transporter permease protein [FtrD]
MALDTTVSRKGTDARVRTRRSMPAGPLALLLAVALLAALTAAVAWGSTSIPPGEVWSVVW
RRLSGDAPRPGTNDLIVWQLRLPRALLAALVGAGLGLVGTAMQALVRNPLADPYFLGVSN
GASLGAVAAIVLGLGSGGALGLGLSGAAFAGALATFALVWAVARRGGGFAPLRLVLAGVA
IGQFLSGFTSYLVLQAGDEQQTHSVLFWLMGSLSGASWPLLAAPAVAVPAVLLLLQARAR
GLNALLMGDETAAGLGIDVVRLRRELFAVTSLLTGVLVAVSGAIAFVALMVPHVCRLVVG
GDHRRLLPVSALFGALLLVVVDIVCRTAMDTQELPVGVVTSLIGAPALLYLLDRRLGSGS
selected fasta
>putative ABC transporter permease protein [FtrD]
ATGGCGCTCGACACCACGGTGAGCCGGAAGGGCACCGATGCCCGTGTGCGCACCCGGCGC
TCCATGCCCGCCGGGCCGCTGGCGCTGCTCCTGGCGGTCGCGTTGCTCGCGGCCCTCACA
GCGGCGGTCGCCTGGGGTTCCACGTCGATACCGCCCGGTGAGGTGTGGAGCGTGGTCTGG
CGCAGACTGAGCGGCGACGCGCCCCGGCCCGGCACGAACGACCTGATCGTGTGGCAACTG
CGCCTGCCCCGCGCCCTGTTGGCGGCCCTGGTGGGTGCCGGGCTCGGCCTGGTCGGTACG
GCGATGCAGGCGCTCGTCCGCAACCCGCTGGCCGACCCGTACTTCCTGGGTGTCTCCAAC
GGCGCCTCCCTCGGTGCCGTCGCCGCCATCGTCCTCGGCCTCGGCAGCGGGGGAGCGCTG
GGCCTCGGTCTGTCCGGTGCCGCTTTCGCGGGAGCCCTGGCCACCTTCGCTCTCGTCTGG
GCGGTGGCGCGGCGCGGTGGCGGATTCGCGCCGCTCAGGCTGGTGCTCGCCGGGGTGGCC
ATCGGGCAGTTCCTGTCCGGCTTCACCAGCTACCTCGTTCTCCAGGCCGGGGACGAGCAG
CAGACCCACAGTGTGCTGTTCTGGCTGATGGGCAGCCTGAGCGGGGCGAGCTGGCCGCTG
CTGGCCGCCCCTGCGGTGGCGGTTCCGGCGGTCCTGCTGCTGTTGCAGGCCCGGGCCCGG
GGCCTGAACGCGCTGCTGATGGGCGATGAGACGGCGGCCGGGCTCGGCATCGACGTCGTA
CGGCTGCGCCGTGAGCTGTTCGCGGTCACCAGCCTGCTCACCGGCGTCCTCGTCGCGGTC
TCCGGGGCCATCGCCTTCGTCGCCCTCATGGTCCCCCACGTCTGCCGCCTTGTCGTCGGC
GGCGACCACCGCCGACTGCTGCCCGTGTCGGCGCTCTTCGGCGCGCTGCTGCTGGTGGTG
GTCGACATCGTGTGCCGCACGGCCATGGACACGCAGGAACTGCCGGTCGGGGTCGTCACC
TCGCTCATCGGCGCTCCGGCTCTGCTGTATCTGCTGGACCGGCGCTTGGGGAGCGGGAGT
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000522 ABC transporter, permease protein (Family)
 [35-352]  1.29999999999998e-93 PF01032
PF01032   FecCD
SignalP
 [1-46]  1 Signal
Bacteria, Gram-positive   
 [1-46]  0.999 Signal
Bacteria, Gram-negative   
 [1-46]  0.988 Signal
Eukaryota   
TMHMM
 [24-46]  Transmembrane (i-o) [84-106]  Transmembrane (o-i) [113-135]  Transmembrane (i-o) [140-162]  Transmembrane (o-i) [174-196]  Transmembrane (i-o) [216-235]  Transmembrane (o-i) [269-291]  Transmembrane (i-o) [306-328]  Transmembrane (o-i) [335-352]  Transmembrane (i-o)
Transmembrane 9