close all open/close all

CDS information : Herb_00090


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction11,362 / 10,286 / - [in whole cluster]
11,362 / 10,286 / - [in contig]
Locationcomplement(10286..11362) [in whole cluster]
complement(10286..11362) [in contig]
TypeCDS
Length1,077 bp (358 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter substrate binding protein
Product (GenBank)lipoprotein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF9p; ORF9; similar to Streptomyces coelicolor SC00996
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Family/Domain
FD
IPR002491

close this sectionSequence

selected fasta
>putative ABC transporter substrate binding protein [lipoprotein]
MRSRVWWGTTAAVLGGLLVAGCGDGGGSGGGDKAGPADEKSATGHYPVTVTDCMDAKTTF
SKAPEKIVTSNASSLELLLRLGAGDNVIGTGFPPGKGTLPGELDAQARKVKALGQSVIPK
EKLLGSGADLYIDTFASMNMGGGMGDAPTEEEFKAAGIKHIYLKSTACAARNKGAVTDLS
AVEADITSLGAVTGTSAKAKELVDGMKGKLDAVRKAVGRTAEGERPTYFFFDYDAGTKQP
TVVCNRQVANAVITLAGARNVFADCDGDYKQVGWEDVISRNPDWIQLGVRDRGSEAANQK
AFDEARKWLESNPATKGLKAVKEGHFLRIGSERTTIGGVENADTVKEIAKALHPGKIG
selected fasta
>putative ABC transporter substrate binding protein [lipoprotein]
ATGCGTTCTCGTGTGTGGTGGGGTACGACGGCCGCGGTGCTGGGTGGCCTCCTCGTGGCG
GGCTGTGGTGACGGAGGCGGCAGTGGCGGCGGTGACAAGGCGGGCCCCGCCGACGAGAAG
TCGGCCACCGGCCACTACCCGGTCACCGTCACCGATTGCATGGACGCCAAGACCACGTTC
TCCAAGGCCCCCGAGAAGATCGTCACCAGCAACGCCTCCAGCCTGGAACTGCTGCTGCGC
CTCGGCGCCGGTGACAACGTCATCGGCACCGGCTTCCCGCCCGGCAAGGGAACGCTGCCC
GGTGAACTCGACGCGCAGGCGCGGAAGGTGAAGGCGCTCGGGCAGTCCGTGATCCCGAAG
GAGAAGCTCCTCGGCTCCGGCGCGGATCTGTACATCGACACCTTCGCCTCGATGAACATG
GGCGGCGGCATGGGCGACGCGCCGACCGAGGAGGAGTTCAAGGCGGCCGGAATCAAGCAC
ATCTACCTCAAGTCCACCGCCTGTGCGGCGCGGAACAAGGGCGCGGTGACCGACCTGTCC
GCGGTGGAGGCCGACATCACCTCCCTCGGCGCGGTCACTGGCACCAGCGCGAAGGCGAAG
GAACTCGTCGACGGCATGAAGGGGAAGCTGGACGCCGTCCGGAAGGCGGTCGGCCGGACG
GCGGAGGGCGAGCGGCCGACGTACTTCTTCTTCGACTACGACGCCGGCACCAAGCAGCCC
ACCGTCGTCTGCAACCGCCAGGTCGCCAACGCGGTGATCACTCTGGCCGGTGCCCGCAAT
GTCTTCGCCGACTGCGACGGCGACTACAAGCAGGTCGGCTGGGAGGACGTCATTTCCCGG
AACCCGGACTGGATCCAGTTGGGCGTCCGCGATCGGGGCAGCGAGGCGGCGAACCAGAAG
GCGTTCGACGAGGCGCGGAAGTGGCTGGAGTCGAACCCCGCCACCAAGGGCCTGAAGGCC
GTCAAGGAGGGCCACTTCCTGCGCATCGGCTCCGAGCGGACCACCATCGGCGGAGTCGAG
AACGCCGACACCGTCAAGGAGATCGCCAAGGCCCTCCACCCGGGCAAGATCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002491 ABC transporter periplasmic binding domain (Domain)
 [67-331]  1e-20 PF01497
PF01497   Peripla_BP_2
 [66-356]  PS50983
PS50983   FE_B12_PBP
SignalP
 [1-22]  0.55 Signal
Bacteria, Gram-negative   
 [1-25]  0.978 Signal
Eukaryota   
 [1-30]  0.908 Signal
Bacteria, Gram-positive   
TMHMM No significant hit