close all open/close all

CDS information : Herb_00100


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction19,043 / 18,360 / - [in whole cluster]
19,043 / 18,360 / - [in contig]
Locationcomplement(18360..19043) [in whole cluster]
complement(18360..19043) [in contig]
TypeCDS
Length684 bp (227 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative amino acid exporter
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF16p; ORF16; similar to predicted RhtB family transporters
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
C6GYU4
NITE
Pimar_00010
PmId
[19505319] PimT, an amino acid exporter controls polyene production via secretion of the quorum sensing pimaricin-inducer PI-factor in Streptomyces natalensis. (Microb Cell Fact. , 2009)

close this sectionSequence

selected fasta
>putative amino acid exporter [unknown]
MSPGRSDSGGGGHVVSTESVLTFAAMSLLVIVIPGPSVLFVVGRALAHGRRTALATVLGN
VIGCYALVVAVAWGLGALVESSVALFMGVKLAGAAYLVYLGVQAFRHRREMRVANMDAPA
DERRGDLRSILDGILVGVTNPKGIVFFAAVLPQFVDHSAGHVPVQMMVLGLVPVTIGLVT
DTLWGLGASAARSWFARSDRRLSMVGGAGGLAMIGLGVTVAATGRAD
selected fasta
>putative amino acid exporter [unknown]
ATGTCCCCTGGACGGAGCGATTCAGGAGGTGGCGGACACGTGGTGTCCACGGAGAGTGTT
CTCACGTTCGCGGCGATGTCGCTCTTGGTGATCGTGATCCCGGGGCCGAGTGTGCTGTTC
GTGGTCGGCAGGGCCCTCGCCCACGGCCGCCGCACGGCGCTCGCGACGGTCCTCGGCAAT
GTGATCGGCTGCTACGCCCTGGTGGTCGCCGTGGCGTGGGGCCTCGGCGCGCTGGTGGAG
AGCTCGGTGGCGCTGTTCATGGGCGTGAAGCTGGCAGGAGCGGCGTATCTCGTCTACCTG
GGTGTGCAGGCGTTCCGGCACCGCAGGGAGATGCGCGTGGCGAACATGGACGCTCCGGCC
GATGAGCGGCGTGGTGATCTGCGTTCGATCCTGGACGGCATTTTGGTGGGGGTCACCAAC
CCGAAGGGCATCGTCTTCTTCGCGGCGGTGCTGCCGCAGTTCGTCGACCACTCGGCGGGT
CATGTTCCCGTCCAGATGATGGTGCTGGGCCTGGTCCCGGTCACCATCGGCCTGGTCACG
GACACCTTGTGGGGCCTGGGCGCCTCGGCGGCCCGCTCCTGGTTCGCCCGCTCGGACCGC
CGCCTCTCGATGGTCGGCGGGGCGGGCGGCCTCGCGATGATCGGCCTGGGTGTGACGGTG
GCGGCGACCGGCCGCGCCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001123 Lysine-type exporter protein (LYSE/YGGA) (Family)
 [29-221]  1.9e-28 PF01810
PF01810   LysE
SignalP
 [1-47]  0.35 Signal
Bacteria, Gram-positive   
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [20-42]  Transmembrane (o-i) [54-73]  Transmembrane (i-o) [83-105]  Transmembrane (o-i) [130-152]  Transmembrane (i-o) [167-189]  Transmembrane (o-i) [202-224]  Transmembrane (i-o)
Transmembrane 6