close all open/close all

CDS information : Herb_00110


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction21,965 / 21,063 / - [in whole cluster]
21,965 / 21,063 / - [in contig]
Locationcomplement(21063..21965) [in whole cluster]
complement(21063..21965) [in contig]
TypeCDS
Length903 bp (300 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative secreted protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF17p; ORF17; similar to Streptomyces coelicolor SC6382
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [putative secreted protein]
MDKPTMGRHRRITQPPRSTLATKAALAAGVLVPTIASVGSAHAATPQAAICTSDRPELAD
KLSEDINSALEGSAATTAISLHDRTTNTTCTLDADRHFDSASTVKVTVLGTLLWDAQKDD
RALTQEEKDHATAMITKSDNDATTALWKQLGADKINGFLHAAGMTNTTLDSEGHWGLTQI
TANDEEKLLQLVTHSNPVLSDDSRAYILKLTGEVIPSQRWGTPAGAPSDAQVHVKNGWLE
RATNGWRVHSLGAFTGGDHDYTITVLSQDNATMDDGIANIEGIARAVHENLNAPASGAQS
selected fasta
>hypothetical protein [putative secreted protein]
ATGGACAAGCCCACCATGGGTCGACACCGACGAATAACCCAGCCTCCCCGTAGCACCCTG
GCGACAAAGGCGGCGCTGGCCGCAGGGGTGCTCGTGCCGACGATCGCCTCGGTGGGGTCG
GCACACGCGGCCACCCCGCAGGCGGCGATCTGCACCTCGGACCGGCCGGAACTCGCCGAC
AAGCTCTCCGAGGACATCAACTCGGCACTGGAGGGCTCCGCCGCCACCACGGCGATCAGC
CTCCACGACCGCACCACGAACACCACCTGCACTCTGGACGCGGACCGGCACTTCGACTCC
GCGAGCACGGTCAAGGTGACCGTGCTCGGCACCCTGCTGTGGGACGCGCAGAAGGACGAT
CGCGCCCTGACGCAGGAGGAGAAGGACCATGCCACCGCCATGATCACGAAGTCGGACAAC
GACGCCACCACCGCGCTGTGGAAGCAGCTCGGGGCCGACAAGATCAACGGGTTCCTGCAC
GCCGCGGGGATGACCAACACCACCCTCGACAGCGAGGGCCACTGGGGGCTCACCCAGATC
ACCGCGAACGACGAGGAAAAGCTCCTCCAACTGGTGACCCACAGCAACCCGGTGCTCAGC
GATGACTCCCGCGCCTACATCCTCAAGCTGACGGGCGAGGTCATCCCCTCGCAGCGCTGG
GGCACCCCGGCCGGTGCGCCGAGCGACGCCCAGGTGCATGTGAAGAACGGGTGGCTGGAG
CGGGCCACCAACGGCTGGCGGGTGCACAGCCTCGGCGCCTTCACCGGCGGCGACCACGAC
TACACGATCACGGTGCTCTCGCAGGACAACGCCACGATGGACGACGGCATCGCCAACATC
GAGGGCATCGCCCGCGCGGTCCACGAGAACCTCAACGCGCCCGCGTCCGGCGCTCAGTCG
TAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR012338 Beta-lactamase/transpeptidase-like (Domain)
 [60-125]  2.7e-26 G3DSA:3.40.710.10 [129-291]  2.80000000000001e-26 G3DSA:3.40.710.10
G3DSA:3.40.710.10   G3DSA:3.40.710.10
 [60-294]  1.20000117458134e-36 SSF56601
SSF56601   PBP_transp_fold
SignalP
 [1-43]  1 Signal
Bacteria, Gram-negative   
 [1-43]  1 Signal
Bacteria, Gram-positive   
 [1-43]  0.99 Signal
Eukaryota   
TMHMM No significant hit