close all open/close all

CDS information : Herb_00120


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction22,946 / 22,155 / - [in whole cluster]
22,946 / 22,155 / - [in contig]
Locationcomplement(22155..22946) [in whole cluster]
complement(22155..22946) [in contig]
TypeCDS
Length792 bp (263 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative hydrolase
Product (GenBank)putative hydrolase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF18p; ORF18; similar to Streptomyces coelicolor SC0267
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q83WC8
PmId
[12542698] Role of Acinetobacter calcoaceticus 3,4-dihydrocoumarin hydrolase in oxidative stress defence against peroxoacids. (Eur J Biochem. , 2003)

close this sectionSequence

selected fasta
>putative hydrolase [putative hydrolase]
MTMRVPVAGGSLDVRVGGDTGPTLVFAHYWGGSADTWNGVLGHLPPGQATVRFDQRGWGT
SRALPGPYHLDQLADDLVRVVEERVSGPFVLVGHSMGGKASQLVAARRPAGLAGLVLVAP
APPQPPAMVTEEYRQGLSHAYDSAETVAHALDHVLTATPLPETVRATAERDSLASGAEAR
QEWPLHGIARDITDATRRIEVPVTVLAAENDMVEPPHILREHLLPHIPHATLTTVPDAGH
LLPAEAPGAVARALGDFLRAIRR
selected fasta
>putative hydrolase [putative hydrolase]
ATGACAATGAGAGTTCCCGTGGCGGGCGGATCGCTCGATGTGCGAGTCGGGGGCGATACC
GGTCCGACGCTGGTGTTCGCCCACTACTGGGGCGGCTCCGCCGACACCTGGAACGGTGTG
CTCGGCCACCTGCCGCCCGGGCAGGCGACGGTCCGCTTCGACCAGCGCGGCTGGGGCACC
TCGCGGGCGCTGCCCGGGCCCTATCACCTCGACCAGCTCGCCGACGATCTCGTCCGTGTG
GTCGAGGAGCGGGTATCGGGGCCGTTCGTCCTCGTCGGCCACTCGATGGGTGGCAAGGCG
AGCCAGCTCGTCGCGGCCCGCCGACCGGCCGGTCTGGCCGGTCTGGTGCTCGTCGCGCCC
GCACCGCCCCAGCCACCCGCCATGGTGACCGAGGAGTACCGACAGGGCCTGTCACACGCC
TACGACTCGGCCGAGACGGTGGCGCACGCCCTCGACCATGTCCTGACCGCCACACCGCTG
CCCGAGACGGTGCGGGCCACCGCGGAGCGCGACAGCCTCGCCTCCGGCGCCGAGGCCCGG
CAGGAGTGGCCCCTGCACGGAATCGCGCGGGACATCACCGATGCCACACGGCGTATCGAG
GTCCCGGTGACGGTGCTTGCCGCGGAGAACGACATGGTGGAGCCGCCGCACATCCTGCGC
GAACACCTCTTGCCCCACATCCCGCACGCGACCCTGACGACCGTCCCTGACGCCGGCCAC
CTGCTCCCCGCGGAAGCCCCCGGCGCCGTAGCCCGAGCCCTCGGAGACTTCCTCAGGGCC
ATTCGGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-34]  0.283 Signal
Bacteria, Gram-negative   
TMHMM No significant hit