close all open/close all

CDS information : Herb_00130


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction23,100 / 23,984 / + [in whole cluster]
23,100 / 23,984 / + [in contig]
Location23100..23984 [in whole cluster]
23100..23984 [in contig]
TypeCDS
Length885 bp (294 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative AraC family transcriptional regulator
Product (GenBank)putative transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF19p; ORF19; AraC family; similar to Streptomyces coelicolor SC0266
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
P09377
PmId
[8230210] A regulatory cascade in the induction of rhaBAD. (J Mol Biol. , 1993)
[10464186] Amino acid-DNA contacts by RhaS: an AraC family transcription activator. (J Bacteriol. , 1999)
[10940041] Genetic evidence that transcription activation by RhaS involves specific amino acid contacts with sigma 70. (J Bacteriol. , 2000)
Family/Domain
FD
IPR018060

close this sectionSequence

selected fasta
>putative AraC family transcriptional regulator [putative transcriptional regulator]
MENGHSAVRQLRYLPAVGSAYGVEVLDFAALRSMDTQRRRTQPQRPDFHVFALVGSGTGS
HEADFHNYRLGEGGAVWIRPGMVHRWSDIDACDGPLILFRPGFLSGFTAAEATTPACWHL
DRQRLPLALLAAEHLGREHSTAVHTPRLASPALLSHLLAALILRALPGTPPSAEAARPGS
RPTEVFRVYRATVEERFAEWHQVADYARALGYDVRTLTRATRAATGTGAKTFLDQRILLE
AKRLLAHTDLPVSGCGRRLGFRDVGNFTTFFRRQTGLPPAAWRAAYSTGGTRGV
selected fasta
>putative AraC family transcriptional regulator [putative transcriptional regulator]
GTGGAAAACGGACACAGTGCGGTGCGGCAACTGCGCTATCTGCCTGCCGTGGGATCGGCG
TACGGGGTGGAGGTCCTGGATTTCGCCGCGCTGCGTTCGATGGACACCCAGCGCCGTCGT
ACCCAGCCGCAGCGCCCCGACTTCCATGTGTTCGCGCTGGTCGGCTCCGGAACCGGCAGC
CATGAAGCGGACTTCCACAACTACCGGCTGGGGGAAGGCGGCGCCGTGTGGATCCGGCCG
GGCATGGTGCACCGCTGGAGCGATATCGACGCCTGCGACGGCCCGCTGATCCTGTTCCGG
CCCGGTTTCCTTTCCGGCTTCACGGCGGCAGAGGCCACCACACCGGCGTGCTGGCATCTG
GACCGGCAGCGGCTGCCCCTCGCCCTGCTCGCGGCCGAACATCTCGGCCGCGAGCACAGC
ACGGCAGTGCACACACCACGCCTGGCATCCCCCGCCCTGCTCTCCCACCTGCTGGCGGCG
CTGATCCTGCGCGCACTCCCGGGCACACCGCCCTCGGCCGAGGCGGCAAGACCCGGCAGC
CGGCCAACCGAAGTGTTCCGGGTCTATCGGGCCACCGTCGAAGAGCGCTTCGCCGAATGG
CACCAGGTGGCCGACTACGCACGGGCGTTGGGCTACGACGTACGCACCCTCACCCGGGCA
ACGCGCGCCGCCACCGGCACGGGCGCCAAGACCTTTCTCGACCAGCGCATCCTGCTGGAG
GCGAAACGGCTGCTCGCCCACACCGATCTGCCGGTCAGCGGCTGCGGCCGACGCCTCGGC
TTCCGGGACGTCGGCAACTTCACCACGTTCTTCCGGCGCCAGACCGGCCTGCCCCCCGCC
GCGTGGCGCGCCGCGTACAGCACCGGCGGCACACGCGGCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003313 Transcription regulator HTH, AraC, arabinose-binding/dimerisation (Domain)
 [29-126]  1.9e-08 PF02311
PF02311   AraC_binding
IPR009057 Homeodomain-like (Domain)
 [236-286]  7.40000780398342e-10 SSF46689
SSF46689   Homeodomain_like
 [238-285]  3.90000000000001e-11 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
IPR011051 RmlC-like cupin domain (Domain)
 [41-102]  2.10000037262656e-07 SSF51182
SSF51182   RmlC_like_cupin
IPR018060 DNA binding HTH domain, AraC-type (Domain)
 [187-285]  PS01124
PS01124   HTH_ARAC_FAMILY_2
 [199-283]  1.60000240695997e-19 SM00342
SM00342   HTH_ARAC
SignalP
 [1-22]  0.206 Signal
Eukaryota   
TMHMM No significant hit