close all open/close all

CDS information : Herb_00140


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction24,797 / 24,036 / - [in whole cluster]
24,797 / 24,036 / - [in contig]
Locationcomplement(24036..24797) [in whole cluster]
complement(24036..24797) [in contig]
TypeCDS
Length762 bp (253 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)putative transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF20p; ORF20; TetR family; similar to Streptomyces coelicolor SC4194
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
P39885
PmId
[1592820] The Streptomyces glaucescens TcmR protein represses transcription of the divergently oriented tcmR and tcmA genes by binding to an intergenic operator region. (J Bacteriol. , 1992)

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [putative transcriptional regulator]
MLSVNTVTPSHLNAPDQLTEGKYIPGAEIYQGQFSVTVDAVDGKPGLRERKKQRTHAAIS
DAAISLFLEHGFNQVSVAQVAEAAEVSKRTLFAYFPTKEDLVVHRLADHETESARVVRAR
PPGTDPLTALREHFLKGLRERDPITGLNDHPAVRRLHRMILDAPSLVARMARFKTGAEHA
LTEALRETADIPELTARLAAVQIVAVHWALADDNAERVAYGEPADERYAGAVADMEHAFA
LLENGLRHLPPQQ
selected fasta
>putative TetR family transcriptional regulator [putative transcriptional regulator]
GTGCTCTCCGTCAACACCGTCACTCCATCTCATCTCAACGCTCCGGATCAGCTCACCGAG
GGTAAATATATACCCGGTGCAGAAATTTACCAGGGGCAGTTTTCTGTTACCGTGGACGCC
GTGGACGGCAAGCCAGGACTACGGGAACGAAAGAAGCAGCGGACCCACGCGGCGATCTCC
GACGCGGCGATCTCGCTGTTTCTCGAACACGGCTTCAACCAGGTCTCGGTGGCCCAGGTG
GCCGAGGCGGCCGAGGTGTCCAAGCGCACCCTCTTCGCCTACTTCCCGACCAAGGAAGAC
CTCGTGGTGCACCGCCTGGCCGACCACGAGACCGAATCCGCACGCGTCGTACGGGCCCGC
CCGCCGGGCACCGACCCACTGACCGCACTGCGCGAGCACTTTCTCAAGGGGCTGCGCGAG
CGGGATCCGATCACCGGGCTCAATGACCATCCCGCGGTGCGCAGGCTGCACCGCATGATC
CTCGACGCGCCCTCGCTGGTGGCCCGGATGGCACGGTTCAAGACCGGCGCCGAGCACGCC
CTGACCGAGGCACTGCGGGAAACGGCGGACATTCCGGAACTCACCGCGCGGCTCGCCGCC
GTCCAAATCGTCGCGGTCCACTGGGCGTTGGCAGACGACAACGCCGAACGTGTGGCGTAC
GGGGAGCCGGCCGACGAGCGCTACGCGGGTGCCGTGGCCGACATGGAGCACGCCTTCGCC
CTGCTGGAGAACGGATTGCGGCACCTGCCCCCGCAACAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [60-102]  6.1e-15 PF00440
PF00440   TetR_N
 [59-72]  1.30000067202732e-08 PR00455 [80-103]  1.30000067202732e-08 PR00455
PR00455   HTHTETR
 [53-113]  PS50977
PS50977   HTH_TETR_2
IPR009057 Homeodomain-like (Domain)
 [47-100]  1.9e-20 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
 [48-123]  1.70000295590054e-17 SSF46689
SSF46689   Homeodomain_like
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [101-246]  6.60000000000002e-13 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
IPR023772 DNA-binding HTH domain, TetR-type, conserved site (Conserved_site)
 [71-102]  PS01081
PS01081   HTH_TETR_1
SignalP No significant hit
TMHMM No significant hit