close all open/close all

CDS information : Herb_00150


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction24,781 / 26,277 / + [in whole cluster]
24,781 / 26,277 / + [in contig]
Location24781..26277 [in whole cluster]
24781..26277 [in contig]
TypeCDS
Length1,497 bp (498 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)HbmL
Gene
Gene (GenBank)hbmL
EC number
Keyword
Note
Note (GenBank)
  • similar to GdmL putative flavin monooxygenase
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q84G26
NITE
Gelda2_00060
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
ACC
Q58PK7
PmId
[16148009] Ablation of the otcC gene encoding a post-polyketide hydroxylase from the oxytetracyline biosynthetic pathway in Streptomyces rimosus results in novel polyketides with altered chain length. (J Biol Chem. , 2005)

close this sectionSequence

selected fasta
>putative oxidoreductase [HbmL]
MLTESTTEVVVAGAGPTGLMLAYELALAGVETLVLEKLPERIQQVKGGTIQPRTAELLES
RGLLEPLLRRAIARGPMGGHFAALPVPLDCTPWRTEHPFPIGIPQWEIEEVLEERATAAG
ARVLRGAAVSGVAPDDDGVVVTADGLRARAHYLVACDGGHSTVRKLLGLPFPGRAGTHQA
VLADIRLSAVSSLVPRQAGHMSTLTRQARGYWSMLVPVGGDRYRFTFGHADQADTARDTA
VTHEEIAAALEAVYGPETTLGGVDNSSRFSDATRQLEHYRTGRVLFAGDAAHIHPPLGAQ
GLNLGVQDALNLGWKLAAVLQDRAPSGLLDSYHAERHPVAAQVLHHTSAQRVLTSPNPSE
DVAALRDIITDLLRLPDTNRHLAGLMSGLSLRYDLPGDHPLTGQRMPDADLVTETGTTRL
STLFGSGHAVLLDLAGAVPADLPLPPRVDLVRATCADDLGAAALLIRPDGYVCWATDTTA
ACGDTLLAALTGDLARVR
selected fasta
>putative oxidoreductase [HbmL]
GTGTTGACGGAGAGCACGACCGAGGTCGTTGTCGCGGGCGCGGGCCCGACCGGGCTGATG
CTGGCGTACGAACTGGCTCTGGCCGGGGTCGAGACCCTGGTGCTGGAGAAGCTGCCAGAG
CGGATCCAGCAGGTGAAGGGCGGCACGATTCAGCCCCGCACCGCCGAACTGCTGGAATCC
CGCGGCCTGCTGGAGCCGCTGCTGCGGCGGGCCATCGCGCGTGGTCCGATGGGCGGCCAT
TTCGCGGCCCTGCCCGTGCCCCTGGACTGCACCCCCTGGCGGACCGAGCACCCCTTTCCG
ATCGGGATCCCTCAGTGGGAGATCGAGGAGGTGCTCGAAGAGCGGGCGACCGCCGCCGGC
GCGCGGGTACTGCGCGGCGCCGCCGTCTCAGGGGTCGCGCCGGATGACGATGGTGTGGTC
GTCACGGCGGACGGTCTGCGGGCGCGGGCTCACTACCTGGTGGCGTGCGACGGCGGCCAC
AGTACGGTGCGGAAACTGCTCGGGCTGCCGTTTCCCGGCCGGGCCGGAACGCATCAGGCG
GTGCTGGCCGATATCCGGCTGTCCGCCGTTTCCTCGCTGGTGCCGCGGCAGGCGGGGCAT
ATGAGCACCCTGACCCGTCAGGCGCGGGGCTACTGGTCCATGCTGGTCCCTGTCGGCGGC
GACCGGTACCGGTTCACCTTCGGGCATGCGGACCAGGCGGACACCGCCCGCGACACCGCC
GTCACCCACGAGGAGATCGCGGCCGCGCTGGAGGCCGTGTACGGCCCCGAGACCACCCTC
GGCGGCGTGGACAACTCCTCGCGGTTCTCCGATGCCACACGGCAACTGGAGCACTACCGC
ACGGGCCGTGTCCTGTTCGCCGGGGACGCCGCGCATATCCACCCCCCGCTGGGCGCCCAG
GGCCTCAACCTCGGCGTACAGGACGCGCTCAACCTCGGGTGGAAACTGGCCGCGGTCCTC
CAGGACCGGGCGCCGAGCGGGTTGCTGGACAGCTACCACGCCGAACGGCATCCGGTCGCG
GCCCAGGTCCTGCATCACACCTCGGCGCAGCGCGTCCTGACGAGTCCGAACCCGAGCGAG
GACGTGGCCGCCCTGCGCGACATCATCACCGACCTGCTGCGCCTGCCCGACACCAACCGC
CATCTCGCGGGGCTGATGTCCGGTCTCTCGCTGCGCTACGACCTGCCAGGCGATCACCCG
CTCACCGGGCAGCGCATGCCGGACGCCGATCTGGTGACCGAGACCGGCACCACCCGGCTG
TCGACACTGTTCGGCTCCGGGCACGCCGTCCTGCTCGACCTGGCCGGAGCCGTCCCGGCC
GACCTCCCGCTCCCGCCACGAGTCGACCTCGTCCGCGCCACATGCGCCGACGATCTGGGC
GCCGCCGCCCTGCTCATCCGCCCCGACGGCTATGTCTGCTGGGCTACGGACACCACCGCC
GCCTGCGGCGACACCCTGCTGGCCGCGCTCACCGGCGACCTCGCGAGGGTGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [7-345]  3.79999999999991e-82 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [8-30]  1.99999636034521e-44 PR00420 [149-164]  1.99999636034521e-44 PR00420 [281-296]  1.99999636034521e-44 PR00420 [296-312]  1.99999636034521e-44 PR00420 [314-332]  1.99999636034521e-44 PR00420 [332-348]  1.99999636034521e-44 PR00420
PR00420   RNGMNOXGNASE
SignalP No significant hit
TMHMM No significant hit