close all open/close all

CDS information : Herb_00160


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction26,795 / 26,325 / - [in whole cluster]
26,795 / 26,325 / - [in contig]
Locationcomplement(26325..26795) [in whole cluster]
complement(26325..26795) [in contig]
TypeCDS
Length471 bp (156 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)HbmX
Gene
Gene (GenBank)hbmX
EC number
Keyword
Note
Note (GenBank)
  • similar to GdmX
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [HbmX]
MTATADYDSLARRLQALEDKEALRALMIRGWRALDRKDWQTWIECWAEDAVLEFGPWEKI
HGKEAVRAKVEEVESPYASMQHHILNMHVDVAGDRATGIGYMWFVAVTEPGSTSSPYSMG
GPYDWEFRRGPDGWLLVRQRLGVWWTDGEDTLRAFA
selected fasta
>hypothetical protein [HbmX]
ATGACAGCGACCGCCGACTACGACAGCCTGGCCCGCAGACTCCAGGCACTGGAGGACAAG
GAAGCCCTGCGCGCCCTCATGATCCGCGGATGGCGGGCGCTGGACCGCAAGGACTGGCAG
ACCTGGATCGAATGCTGGGCCGAGGACGCGGTGCTGGAGTTCGGGCCGTGGGAGAAGATC
CACGGAAAAGAGGCGGTCCGGGCCAAGGTGGAGGAGGTGGAATCACCCTACGCGAGCATG
CAGCATCACATCCTCAACATGCACGTCGACGTGGCGGGCGACCGGGCGACGGGGATCGGC
TACATGTGGTTCGTCGCCGTCACCGAGCCCGGGAGCACCTCCTCCCCCTACTCCATGGGC
GGCCCCTACGACTGGGAATTCCGCCGGGGCCCGGACGGCTGGCTCCTGGTCCGCCAGCGG
CTCGGTGTCTGGTGGACCGACGGCGAGGACACCTTGAGGGCCTTCGCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-33]  0.125 Signal
Bacteria, Gram-negative   
TMHMM No significant hit