close all open/close all

CDS information : Herb_00170


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction27,677 / 48,139 / + [in whole cluster]
27,677 / 48,139 / + [in contig]
Location27677..48139 [in whole cluster]
27677..48139 [in contig]
TypeCDS
Length20,463 bp (6,820 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)HbmAI
Gene
Gene (GenBank)hbmAI
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)

close this sectionPKS/NRPS Module

0
1 methylmalonyl-CoA
2 methoxymalonyl-ACP
3 methylmalonyl-CoA
A36..442
PCP997..1067
KS1087..1463
AT1627..1945
DH1993..2159
ER2475..2775
KR2785..2965
ACP3062..3136
KS3158..3532
AT3708..4029
DH4077..4237
ER4535..4833
KR4843..5023
ACP5126..5196
KS5223..5598
AT5758..6077
KR6383..6563
ACP6662..6735

close this sectionSequence

selected fasta
>polyketide synthase [HbmAI]
MLRTDLIRPVPELLRANADRFGDKPACSDGHRTVSHAELERRTRRLAGHLAGLRLHPGDR
AMICLGNRVETVESYFGVLRANGVAVPVNPRSTDAELSYLLADSGARLVLTDVAHAEQFD
RLREQFPELRVVVSGDGPLPKGFIAFEPLPDTEPDLAARDDLGLDEVAWMLYTSGTTGLP
KGVLSTQRNCLWSLAACYVPVTGLTAEDRVLWPLPLFHSLSHIVCLLAATAVGAGTRIVD
GVSTSDVLDALREERSTFIAGVPTLYHHLIEAARERDFATPELRIALVGGAVATADLVRS
FEATFGVPLVDAYGSTETCGAIAVNWPTGPRVEGSCGLPVPGLTVRLVDPDTGVDVPAGR
EGEFWVSGPNIMAGYHNQPEATAAALRDGWYRTGDLGRRDEAGFCTVTGRIKELVIRAGE
NIHPGEVEAVLRTVPGVADAAVVGKPHAVLGEVPVAFVVPGPDGFDPSALLATCRERLSY
FKVPEEIYEIARVPRTASGKITRHVLLELPARLRAAGDGQYDSLLRLDWVPHPALPDAPA
GTGTWALVDADALGAGLAEGLRAAGVDVADPVADYVADPVADVAGDDGAAPDVVVVAPQV
VGLPEEAGVPDEAGVTAGEAADRLAARLGTWLADDRLAGTTFVVATTGAVATGSEENAPE
PLSAALWGVVRSLQAAYPGRLTLVDVDDEGGGAGEDGRVAALLRAVQDGHDQAAIRGGVL
LVPRLTRISVPAEPGPAPALDPDGLVVITGGDTARGTALARHLVTAYGARNLLLLSANGL
PEEAAAALRTELARDGAQVSMAVCDPAERAALDSVLDAQDRPVTAAVHIEEPGPERSLAT
SLRGMTHLEERTRTAGPALFVVVTSAAGVLGSPGRPDLAAVDQFGEALVRRRRALGLSGL
ALAWGPLPGEQGTAPVAGAVPLPEALALFDAALTAGQGPLVLLRPSTTGLAGGEPVPAVL
RHLVDAPSGVPASDEPAAAEFRRRLAAESESGRRHMALALVREHAAAALGLASADPVEAD
QAFSAFGFTSLTAVALRNRLNAATGARLAATVVFDHPTPAGLARHLVREITGKRSVRAPV
RARGVSDEPVAIVAMGCHLPGEVATPEDLWRLVADGRDAIAGFPEDRGWDLAGLFDSDPD
AVGKSYVREGGFLTGAGGFDAAFFGISPREALAMDPQQRLLLETAWETFENAGIDPGSLH
GTDVGVFSGVMYHDYGADAGTAAEGLEGHLGVGSAGSVVSGRVAYAMGLTGPAVTVDTAC
SSSLVALHLAVQAVRTGECSLALAGGVAVMSRPTSFIEFSRQRGLAPDGRCKSFAEGADG
TNWSEGVGLVLLERLSDARRNGHEVLAVVRGTAVNQDGASNGLTAPNGPSQERVIRQALA
NAGLTVADVDAVEAHGTGTSLGDPIEAQALLATYGQERPEGQPLWLGSLKSNIGHAQAAA
GVAGVIKMVLAMRHNTLPKTLHAERPTTQVDWSQGAVSLLSEARPWPETGHPRRAGISSF
GVSGTNAHVVLEQAPPEVAVPEAEASEAGTPGLVATGGVVPWMLSGKTPAALRAQAERLV
SHLESGDAPRAVDVGWSLATTRAALDHRAVILATDTEDGIATARALAEGRPDPLLVTGQT
GTDGKTVFVFPGQGAQWVGMGAQLLNTSPVFATRLHECADALAPYTDWSLIDVITGAPDA
PSLDRVDVVQPATFAVVVSLATLWQSMGIHPDAVTGHSQGEIAAACVAGHLTLTNAAKIV
ALRSQIIADHLAGHGGMMSLATPADTIDLTNWHGKLWIAAHNGPNATVIAGDAEALHQLH
AHYTDQGTRARIIPVDYASHTGHVDTIKNELHQTLADTTTEPGTLPWLSTVDGEWIEPDT
LDSGYWYRNLRQTVQFHTAITTLADQGYRTYIEISPHPVLTTAIQETLETHNTPNAIVTG
TLRRDDDTPTRLLTNLAHLTTHGTPVNWPTLFTGTHPTRITLPTYPFQHHHYWLPRNTTT
GDVSAVGLQGTGHPLAGAVVSVPDTGGVLLTGQLSVATHPWLADHAVSGTVLLPGAAMAE
LAIRAGDETATPTLEELVIGQPMTLPEDGALHVQALVGGEEDGRRGVRIYSRPDAAQEQE
WLEHASGTLATQPDGSAEGGREDGMAEWPPPGVEPIALDHFYDDLAQAGYEYGPAFRGLK
AVWKRDGEVGEVFAEAALPEEQTEAAGRFGIHPALLDAALHASNFCVPPVPGQTLLPFVW
NDVRLLAAGATAVRVRARATGPDSFTISLYDSTGSPVASVDSLVLRAISPEQLAAASGGA
DRSADALFTVDWTEHPTALGTEVSWTTLGDTHTHADVDAAMDALIAGEDRPGAVVADTTA
WAAGDTELPTRARDLAARALDLVQRWLAQPELDDVRLVLLTRGAVSVHDTAEVTDPAAAA
IWGLVRSAQSEHPGRIALVDTDDASREALPEAVASGEPQVALRRGLLWVPRLVRSSQGLA
VPAHEHWYLDVSEKGSLENLVLRPDPEATAPLATGQVRIEVRAAGQNFRDVLVALGGVAG
QEGLGGEGAGVVTEVGPGVEGLAVGDRVMGLFPRSFGPLATADARTVAPIPEGWSYATAA
GVPVAYLTALYGLRDLGNVQPGETVLVHAAAGGVGMAAVQLARHFGALVYATAHPSKHHV
LTALGVPEGHLASSRDLGFASAFPALDVVLNSLTGEYVDASLGLLGTGGRFVEMGKNDIR
DPAVVAAAHPGVGYQAFDLGGDAGPDRIRELLTELVELFEAGRIEPLPVRQWDITRAPEA
FRWMSQGRHTGKIVLTLPRALDPDGTVLITGGTGTLGATVARHLVTQHGTRRLLLVSRRG
PDAPGATDLTTELTELGATVHITACDTADRDQLATTLADIPADHPLTAVIHTAGTLDDGT
LTALTPDRLDTVFRPKVDAITHLHHLTHDHDLAAFVIYSSAAGTLGNAGQANYAAANAFL
DAFAQWRHARHRPATSLAWGLWSDTSTLTATMDATDVRRTRRAGVLGMDNAEALRVFDTG
LRSGRPALVAAKIDLTALRAPDAELSPLLRGLARPARRTARTAAPAAGGLSGQLAGLSPA
GQREFLLNLVRAEAAVVLGHTGPEAIEPTVAFKEMGFDSLTAVELRNRLNAATGLRLPAT
LLFDHPTPALLTELFHTELGGGPAPAAAAPVTVRAAADEPIAVVAMSCRLPGGVTDPDGL
WNLLLGERDGITDFPRDRGWDLEALFDADPDRSGTSYVLRGGFLEDAAGFDADFFGISPR
EALAMDPQQRLFLEACWEVFERAGMDPTAVGGGDIGVFAGVINQDYGVRSGPAPEDLEGY
MLTGSATSVASGRVAYVLGLEGPAVTVDTACSSSLVAMHWAVQALRQGECSMALAGGATV
MGRPSAFVEFSRQRGLAPDGLCKAFGAGADGTTFSEGVGVLLLERLSDARRNGHEVLAVV
RGTAVNQDGASNGLTAPNGPSQQRVIRQALANAGLSATDIDAVEAHGTGTALGDPIEAQA
LLATYGQDRPGDEPVWLGSLKSNTGHTLAAAGVSSVIKMVLAMRNGTLPRSLYADEPTPE
VDWSQGAVSLLTEARPWPETGHPRRAGISSFGISGTNAHLILEQAPQPEPQAETDPEPEA
APKADDGMATPGLVATGGSVPWVLSAKTATALRAQAQRLLDHLESGVTDRPLDIGWSLAT
TRTLHDHRAVILTDTEGADATAALTALATEQPHPRLTTGHATTHGKTVFVFPGQGAQWAG
MGAQLLDTSPVFATRLHECAKALAPYTDWSLIDVITGAPDAPSLDRVDVLQPTTFAIMVS
LAALWQANGIHPDAVIGHSQGEIAAACVAGHLTLTNAAKIVTLRSQTIAHHLTGHGAMMS
VLASPTWVQETLAPWHGHLWIAAVNGPASVSVSGDPDALAEFGTTLSKAKVYRWQLPGVD
FAGHSGHVDTIKDQLHNVLDGITATPGHTAWMSTVDADWANPTHIDPDYWYRNLRDTVRF
EEATRALLTQGYRVFIEVSTHPVLTTAIQDTTESLPDTPTTITGTLRRDDGGPDRVLTSL
AELSAAGIPVHWPTAYAGTTPSQVPLPTYPFQHQHYWLAATGHHGDVGSVGLRDAAHPLL
GAVVSVPDTGGVLLTGRLAPSAQSWLADHMLSGVALVPGTAIVELAVRAGDETGTPVLEE
LVLGQPMLLPEDGSLQVQVLVGAAEDDERRTVRVYSRGDESEPWVEHASGILSAQALIPV
EAERQWPPAGAEPVALEGFYDRLAEAGYEYGPVFRGLTAAWTRDGDVFAEVTLGEEQHDL
ARRFGIHPALLDAALHASNFCPGNEPGGGTYLPFSWNGVQLHADGATALRVRVTSTGPDN
LSLYATDPHGVPVVTVGSLVLRETTAEQLRTTSASSTADSQFTVEWTEHALARDEVAWAA
LDAVPDQDTWPPVVVADTRAYTAEGGELPERARALTCRALAAIRRLISDDALADSRLVLL
TRGGMAVHDDTEVTDPAAAAVWGLVRAAQAEHPGRVCVIDTDDRSAEALPAALATEEPQL
ALRGGIAWVPRLVRARPGLAVPATAAWHLDVTEHGTLENLALVPHPRAEAPLEAGQVRIA
VRAAGQNFRDVLIALGMYEAEIGTEGAGVVTEVGPGVADLAVGDRVMGMLPGSFGPLVVA
DRRTVVRMPRGWSFTAAAGVPVAYLTALYALRDLGDVQPGETVLVHAAAGGVGMAAVHLA
HHFGATVLATAHPAKHHSLEQLGVATERRASSRDLAYAHTFPTTDIVLNSLTGEHIDASL
RLLNPGGRFIEMGRTDIRDVDEVAATHPDRTYRAFDLGADAGPDRIQELLVELVDLFEQG
LIPPLPTRPWEITRAPDAFRWMSQGRHTGKIVLTLPRTPDPDGTVLITGGTGTLGTAIAR
HLVTHHGVRNLVLTGRQGPNAPGAADLHDELTALGAQVRITACDSADRGQLAALLAGIPS
DHPLTGIVHTAGTLADGTLTTLDPDRIDTVFRPKVDAVTHLHDLTRDQDLALFAVYSSAA
GILGNAGQANYAAANTFLDAFVQQRRAAGLAGLSLAWGLWAETSELSAALITANRDRTRH
GVVRPMTTEHALSLFDSALGLGLPLVVPAKLDPGAHESAAGAVSPLLTGLVRPTRRTLRS
TSGQSGEGGLTARLAALSEADQHRLLLDLVRDHTATVLGHTGKDAVDARRAFSDIGVDSL
IAVELRNRLAGATGLRLPATVVFDYATPEAMAGHLRSVVAGDTAAPASPSTSAPASAVAP
ADDPVAIVSMNCRLPGKVTGPGELWDLVSQGRDAIGPFPTDRGWDVETLFDLDPDAVGKS
YVREGGFLTGAGDFDAEFFGISPREALAMDPQQRLLAETSWELFEQAGIDPMSVRGQAIG
VFAGVIDQGYIAHSEAPPPELEGYLMTGSTTSVASGRVAYLLGLEGPAVTVDTACSSSLV
ALHLAVQALRAGECSMAITGGVTVIAKPGGFISFSRQRGLAPDGRSKSFSEGADGTTFSE
GIGLVLLERLSDARRNGHEVLAVIRGTAVNQDGASNGLTAPNGPSQQRVIRQALSNAGLT
VADVDAIEAHGTGTALGDPIEAQALLATYGQDRPGDEPVWLGSLKSNIGHTQAAAGIAGL
IKMVLAMRHGMLPPSLHAGEPTTKVDWASGAVSLLSEARPWPETGHPRRAGISSFGISGT
NAHVILEQGPEVAVPEAETGAPGLVATGGVVPWVLSAKSPAGLRAQAERLVSHLESGDAP
RAVDVGWSLATTRAALDHRAVILATDTEQGTATVRALAEGRPDPLLVTGQTGTDGKTVFV
FPGQGAQWVGMGAQLLSTSPAFATRLRECADALAPYTDWSLIDVITGAPDAPSLDRVDVV
QPATFAVVVSLATLWQSMGIHPDAVTGHSQGEIAAACVAGHLTLDAAAKIVALRSQIIAD
HLAGHGGMMSVLASREQVEEALTPWQGKLWIAAHNSPQATVVAGDIDALHELHAHYTDQD
IRARIIPVDYASHTGHVDTIKNELHQTLADTTTEPGTLPWLSTVDGEWIEPDTLDSGYWY
RNLRQTVQFHTAITTLADQGYRTYIEISPHPVLTTAIQETLEANDTSNTTITGTLRRDDD
TPTRLLTNLAHLTTNGHTPDWTALYSATHPHPTPLPTYPFQHHHYWLTPSEVPEAVADGV
FWETVERGDLASLADSLGVEEKALEPVLPGLTSWRRRNQDQSTVDAWSYRIAWDPVASGE
APVLPGAWLVAVASPQTSDTAVTGVIAALAAHGADPVVVEVDTVERAEVTALLRERMSGS
DDEYAGVLSLLAWDERTCEPGTLSRGVAATVALMQAVEEIGLTAPLWCLTRGAVAVREPS
EVTSEFQPLAWGMGVVQGLDQPSTWGGIVDLPRTPDDTALARLCSVLAGVDAEDQVAVRA
SGVFARRMRREPVTSAPAWQPRDTVLITGGTGGLGSYVARWAAGHGARRVVLLSRQGAQA
AGAAELEAELTALGADVTIAACDVTDRDQLAAVLAEIPDDVPLSAVVHAAGLALPEKPLS
KMTLAEFADIGRAKIAGARHLDDLLGERELDAFVLFSSGAAAWGSGGQSAYAAGNAYLDG
LAQRRRARGLAATSVAWGAWGGGLGTIDEAMGAQWRRTGLMTMDPRLAALAMAHTVGSGT
AHGVVADIDWERFAPGYTLARFRPLLRGLPDVIDLLTEDTHEDGAGQTELIARLAGLSPG
DQERLLTELVQAEAAAVLGHASADATGDRPFSEIGFDSLTAVELRNRLNAGTGLKLPATM
VFDHPRPSALARRIRTELGQTDTSSVDSVLAELERLEAHLAALPKEKIERARITSRLQRM
TTKVAEIEANGAGGETVTERLDTANADDVFAFIDQEFGVD
selected fasta
>polyketide synthase [HbmAI]
ATGCTACGGACTGACCTGATCCGGCCGGTGCCCGAACTGCTCCGGGCCAACGCGGATCGC
TTCGGTGACAAGCCGGCCTGTTCCGACGGACACCGCACGGTCAGCCATGCCGAACTCGAA
CGCCGTACCCGGCGGCTGGCCGGTCATCTCGCCGGACTGCGGCTGCACCCCGGCGACCGC
GCCATGATCTGCCTGGGCAACCGCGTCGAGACGGTGGAGAGCTACTTCGGCGTTCTGCGG
GCGAACGGCGTGGCGGTGCCGGTCAACCCGCGTTCGACCGATGCGGAACTCTCCTATCTG
CTCGCCGACAGCGGCGCCCGGCTGGTGCTCACCGATGTCGCCCACGCCGAGCAGTTCGAC
CGGCTGCGGGAACAGTTCCCGGAGCTGAGGGTGGTGGTCAGCGGGGACGGGCCGCTGCCG
AAGGGCTTCATCGCGTTCGAGCCGCTGCCGGACACGGAGCCGGACCTGGCGGCCCGCGAC
GACCTGGGCCTGGACGAAGTCGCCTGGATGCTCTACACCTCGGGCACCACGGGCCTGCCG
AAAGGCGTGCTGTCCACCCAGCGGAACTGCCTGTGGTCCCTGGCCGCCTGCTACGTACCG
GTGACGGGGCTGACCGCCGAGGACCGTGTGCTGTGGCCGCTGCCGCTGTTCCACAGCCTC
TCGCACATCGTGTGTCTGCTGGCGGCCACCGCCGTCGGGGCCGGCACCCGGATCGTGGAC
GGGGTGTCGACCTCCGATGTGCTGGACGCGCTGCGCGAGGAGCGGTCGACCTTCATCGCC
GGAGTGCCGACGCTCTACCACCATCTGATCGAGGCTGCCCGCGAGCGCGACTTCGCCACG
CCCGAGCTGCGGATCGCGCTCGTGGGCGGGGCGGTGGCCACGGCCGACCTGGTCAGGTCG
TTCGAGGCCACCTTCGGAGTGCCACTCGTCGACGCCTACGGATCCACCGAGACCTGTGGC
GCGATCGCGGTGAACTGGCCCACCGGCCCACGGGTCGAGGGGTCGTGCGGGCTGCCGGTG
CCGGGGCTGACGGTGCGGCTGGTGGACCCCGACACCGGTGTCGACGTTCCGGCCGGGCGG
GAAGGCGAGTTCTGGGTGTCCGGGCCGAACATCATGGCCGGGTACCACAACCAGCCGGAG
GCGACGGCCGCGGCGCTGCGCGACGGCTGGTACCGCACCGGGGACCTCGGCCGCCGTGAC
GAGGCCGGATTCTGCACGGTGACCGGCCGGATCAAGGAACTCGTCATCCGGGCCGGGGAG
AACATCCACCCCGGTGAGGTCGAGGCCGTGCTGCGCACCGTGCCGGGTGTGGCGGACGCG
GCCGTGGTGGGCAAGCCGCACGCGGTGCTCGGCGAGGTCCCGGTGGCCTTCGTGGTGCCC
GGCCCGGACGGCTTCGACCCGTCGGCGCTGCTGGCCACGTGTCGTGAGCGGCTGTCGTAC
TTCAAGGTCCCGGAGGAGATCTACGAGATCGCGCGGGTGCCGCGCACCGCCTCGGGGAAG
ATCACCCGGCACGTACTGCTGGAGCTGCCCGCACGGCTGCGGGCCGCCGGGGACGGCCAG
TACGACTCGCTGCTGCGGCTGGACTGGGTGCCGCATCCCGCGCTGCCGGACGCCCCGGCC
GGGACCGGAACCTGGGCGCTGGTGGACGCGGACGCGCTCGGGGCCGGGCTCGCGGAGGGG
CTGCGGGCGGCGGGGGTGGACGTGGCCGATCCGGTGGCCGATTACGTGGCCGATCCGGTG
GCCGATGTCGCTGGAGATGACGGTGCGGCTCCGGACGTGGTCGTGGTTGCGCCTCAGGTG
GTGGGCCTCCCCGAAGAAGCGGGGGTCCCCGACGAGGCCGGGGTCACGGCTGGCGAGGCG
GCCGACCGGCTGGCGGCCCGGCTGGGCACCTGGCTGGCCGACGACCGGCTGGCCGGGACG
ACGTTCGTGGTGGCCACCACTGGCGCGGTGGCCACCGGCTCCGAGGAGAACGCACCGGAG
CCGCTGTCGGCCGCGCTGTGGGGTGTGGTGCGCTCGCTCCAGGCCGCCTACCCCGGCCGA
CTGACGCTGGTGGACGTGGACGACGAAGGGGGCGGGGCCGGGGAGGACGGTCGGGTGGCC
GCGCTGTTGCGGGCCGTACAGGACGGGCACGACCAGGCGGCGATCCGTGGCGGAGTGCTG
CTGGTCCCGCGCCTGACGCGGATCTCGGTCCCGGCGGAGCCGGGGCCCGCCCCGGCCCTG
GACCCGGACGGACTGGTCGTGATCACCGGTGGCGACACCGCCCGCGGCACCGCGCTGGCC
CGCCATCTGGTGACCGCGTACGGCGCCCGTAACCTGCTGCTGCTCAGCGCGAATGGCCTG
CCGGAAGAGGCGGCGGCCGCGTTGCGGACCGAGTTGGCGCGGGACGGGGCCCAGGTCTCG
ATGGCCGTGTGCGACCCGGCCGAGCGGGCGGCGCTGGACTCGGTGCTGGACGCACAGGAC
CGGCCGGTGACCGCTGCCGTACACATCGAGGAGCCGGGTCCGGAACGGTCGCTCGCCACC
TCGCTGCGCGGCATGACGCACCTGGAGGAACGGACGCGGACGGCCGGGCCCGCGCTGTTC
GTCGTCGTCACCTCCGCCGCGGGGGTGCTGGGCTCGCCGGGTCGCCCGGACCTGGCGGCC
GTCGACCAGTTCGGCGAAGCCCTGGTGCGGCGGCGCCGGGCGCTCGGCCTGAGCGGGCTG
GCGCTGGCTTGGGGGCCGCTGCCGGGCGAGCAGGGCACGGCACCGGTGGCCGGTGCCGTT
CCCCTGCCCGAGGCGCTGGCCCTGTTCGACGCGGCGCTGACGGCTGGTCAGGGCCCACTG
GTGCTGCTCAGGCCGAGTACGACGGGGCTGGCGGGTGGCGAGCCGGTGCCCGCGGTGCTG
CGTCACCTGGTGGACGCGCCGTCCGGCGTACCGGCGTCGGACGAACCCGCCGCCGCGGAG
TTCCGGCGGCGGCTGGCCGCCGAGAGCGAGTCCGGCCGCCGGCACATGGCACTGGCGCTG
GTGCGCGAGCACGCCGCGGCGGCGCTGGGGCTGGCCTCGGCCGACCCGGTCGAGGCCGAC
CAGGCGTTCAGCGCGTTCGGCTTCACCTCACTGACCGCGGTCGCGCTGAGGAACCGGCTG
AACGCGGCCACCGGGGCACGGCTCGCCGCCACGGTGGTCTTCGACCATCCGACCCCCGCC
GGGCTGGCACGCCATCTGGTGCGGGAGATCACCGGGAAGCGAAGCGTGCGGGCGCCGGTG
CGGGCGCGCGGGGTGTCCGACGAGCCGGTGGCGATCGTGGCGATGGGCTGCCACCTGCCC
GGCGAGGTCGCGACGCCCGAGGACCTGTGGCGGCTGGTGGCCGACGGGCGGGACGCGATC
GCCGGGTTCCCGGAGGACCGGGGCTGGGACCTGGCCGGGCTCTTCGACTCCGACCCGGAT
GCCGTGGGCAAGTCCTACGTCCGCGAGGGCGGTTTCCTCACCGGCGCGGGCGGATTCGAC
GCCGCCTTCTTCGGCATCTCGCCCCGCGAGGCGCTGGCCATGGACCCGCAGCAGCGGCTG
CTGCTGGAGACCGCGTGGGAGACCTTCGAGAACGCCGGAATCGACCCGGGTTCGCTGCAC
GGCACCGACGTCGGTGTGTTCAGCGGAGTGATGTACCACGATTACGGGGCCGACGCCGGG
ACGGCGGCGGAGGGCCTGGAGGGGCATCTCGGCGTGGGCAGCGCGGGGAGCGTCGTCTCC
GGACGCGTGGCCTACGCGATGGGCCTGACCGGGCCCGCGGTGACGGTGGACACCGCCTGC
TCGTCCTCCCTGGTGGCGCTGCACCTGGCGGTTCAGGCGGTGCGTACGGGCGAATGCTCG
CTGGCGCTCGCCGGGGGTGTCGCGGTGATGAGCAGGCCGACGTCGTTCATCGAGTTCTCC
CGCCAGCGCGGCCTCGCCCCCGATGGCCGCTGCAAGTCGTTCGCGGAGGGCGCCGACGGC
ACCAACTGGTCCGAGGGTGTCGGGTTGGTGTTGCTGGAGCGGCTGTCCGATGCCCGCCGC
AATGGGCATGAGGTGCTCGCCGTGGTCCGTGGCACGGCGGTGAACCAGGACGGGGCGAGC
AACGGCCTGACCGCGCCCAACGGCCCTTCCCAGGAACGGGTGATCCGGCAGGCGCTGGCG
AACGCCGGGCTGACGGTGGCCGATGTGGACGCGGTCGAGGCGCACGGCACCGGCACGAGT
CTCGGCGACCCCATCGAGGCCCAGGCGCTCCTGGCCACCTACGGGCAGGAGCGGCCGGAG
GGTCAGCCGCTGTGGCTGGGGTCGTTGAAGTCGAACATCGGGCATGCGCAGGCGGCGGCG
GGCGTGGCCGGTGTCATCAAGATGGTGCTGGCCATGCGGCACAACACGCTGCCGAAAACG
CTGCACGCGGAGCGGCCCACTACGCAGGTGGACTGGTCGCAGGGTGCGGTGTCGCTGCTG
TCCGAGGCCCGGCCCTGGCCGGAGACCGGACACCCCCGCCGCGCCGGAATCTCCTCCTTC
GGCGTCAGCGGGACGAATGCCCATGTGGTCCTGGAGCAGGCGCCGCCTGAGGTGGCCGTG
CCCGAAGCAGAGGCCAGCGAGGCGGGCACTCCTGGGCTGGTGGCCACGGGCGGCGTGGTG
CCGTGGATGCTGTCGGGTAAGACTCCTGCGGCGCTGCGCGCCCAGGCCGAGCGTCTGGTC
AGCCACCTGGAATCCGGGGACGCTCCGCGTGCGGTGGACGTGGGCTGGTCACTGGCCACC
ACGCGCGCCGCCCTCGATCATCGCGCGGTCATCCTCGCCACGGATACCGAGGACGGCATC
GCCACCGCCCGCGCTTTGGCGGAGGGACGGCCCGACCCGCTCCTGGTCACCGGGCAGACC
GGGACAGACGGCAAGACCGTGTTCGTCTTCCCCGGCCAGGGAGCCCAGTGGGTGGGCATG
GGGGCACAACTCCTCAACACCTCGCCCGTCTTCGCCACCCGGCTACACGAGTGCGCCGAC
GCGCTGGCCCCGTATACCGACTGGTCGCTCATCGACGTCATCACCGGCGCACCCGATGCC
CCTTCGCTCGACCGTGTCGACGTCGTACAGCCCGCCACCTTCGCCGTCGTCGTCTCCCTC
GCCACCCTCTGGCAATCCATGGGTATCCACCCCGACGCCGTCACCGGCCACTCCCAAGGC
GAAATCGCCGCAGCCTGCGTCGCCGGACACCTCACCCTCACCAACGCCGCCAAAATCGTC
GCCCTGCGCAGCCAGATCATCGCCGACCACCTCGCCGGACACGGCGGCATGATGTCCCTC
GCCACCCCCGCCGACACCATCGACCTCACCAACTGGCACGGCAAACTCTGGATCGCCGCA
CACAACGGCCCCAACGCCACCGTCATCGCAGGCGACGCCGAAGCCCTGCACCAACTCCAC
GCCCACTACACCGACCAAGGCACCCGAGCCCGCATCATCCCCGTCGACTACGCCTCCCAC
ACCGGACACGTCGACACCATCAAGAACGAACTCCACCAAACCCTGGCCGACACCACCACC
GAGCCCGGCACCCTCCCCTGGCTCTCCACCGTCGACGGGGAGTGGATCGAACCCGACACG
CTCGACAGCGGCTACTGGTACCGGAACCTGCGCCAAACGGTGCAGTTCCACACCGCCATC
ACCACCCTCGCCGACCAGGGCTACCGCACCTACATCGAAATCAGCCCCCACCCCGTCCTC
ACCACCGCCATCCAAGAAACCCTCGAAACACACAACACCCCCAACGCGATCGTCACCGGA
ACCCTCCGCCGCGACGACGACACCCCCACCCGCCTCCTCACCAACCTCGCCCACCTCACC
ACCCACGGAACACCCGTCAACTGGCCCACCCTCTTCACCGGCACACACCCCACCCGCATC
ACCCTCCCCACCTACCCCTTCCAACACCACCACTACTGGCTCCCCCGCAACACCACCACA
GGCGATGTGAGTGCCGTGGGCCTCCAGGGCACGGGCCACCCGCTGGCCGGGGCCGTGGTG
AGCGTGCCCGACACCGGTGGTGTGCTGCTCACCGGGCAACTGTCGGTGGCCACCCACCCC
TGGCTGGCCGACCACGCCGTCTCCGGAACCGTCCTGCTGCCCGGCGCCGCGATGGCCGAA
CTCGCCATCCGCGCCGGAGACGAGACCGCCACCCCCACCCTGGAAGAACTGGTCATCGGC
CAGCCGATGACACTGCCCGAAGACGGTGCGCTGCACGTCCAGGCACTGGTCGGCGGCGAG
GAGGACGGGCGCCGAGGGGTACGGATCTACTCCCGCCCCGACGCGGCCCAGGAACAGGAA
TGGCTGGAGCACGCCTCGGGCACGCTCGCCACGCAGCCGGACGGTTCGGCCGAGGGTGGC
AGGGAAGACGGCATGGCCGAGTGGCCGCCGCCCGGTGTCGAACCGATCGCTCTGGATCAC
TTCTACGACGACCTCGCCCAGGCCGGGTACGAGTACGGCCCCGCGTTCCGCGGGCTGAAG
GCGGTCTGGAAGCGCGATGGCGAAGTGGGCGAGGTGTTCGCGGAGGCCGCGCTGCCGGAG
GAGCAGACGGAGGCCGCCGGCCGGTTCGGCATCCACCCGGCACTGCTGGACGCCGCGTTG
CACGCGAGCAACTTCTGTGTGCCCCCGGTCCCGGGCCAGACGCTGCTCCCCTTCGTGTGG
AACGACGTACGGCTGCTGGCGGCGGGAGCCACGGCCGTCCGTGTGCGCGCCCGTGCCACC
GGCCCGGATTCGTTCACGATCAGCCTGTACGACAGTACCGGCTCCCCCGTCGCCTCGGTG
GACTCCCTGGTGCTCCGGGCGATCAGTCCCGAGCAGCTCGCCGCCGCGTCCGGCGGCGCC
GATCGGTCCGCTGATGCGCTGTTCACGGTGGACTGGACCGAGCACCCCACCGCCCTGGGG
ACCGAGGTCTCCTGGACCACCCTCGGCGACACCCACACCCACGCCGACGTGGACGCAGCC
ATGGACGCGCTCATCGCGGGAGAGGACCGCCCCGGGGCCGTGGTCGCCGACACCACGGCC
TGGGCCGCCGGGGACACCGAGCTGCCCACGCGGGCCAGGGACCTGGCCGCCCGCGCGCTG
GACCTGGTGCAGCGATGGCTAGCCCAACCCGAACTCGACGACGTCCGGCTGGTGTTGCTC
ACCCGTGGGGCGGTGTCCGTACACGACACCGCCGAGGTCACCGATCCGGCCGCCGCCGCG
ATCTGGGGCCTGGTCCGCTCCGCCCAGTCCGAACACCCGGGCCGGATCGCCCTGGTGGAC
ACCGACGACGCGTCGCGGGAGGCGCTGCCCGAGGCGGTGGCGTCCGGCGAACCGCAGGTG
GCGCTGCGCCGTGGGCTGCTGTGGGTGCCGCGTCTGGTGCGGTCGTCGCAGGGTCTCGCC
GTACCCGCCCACGAGCACTGGTACCTCGACGTCTCGGAGAAGGGCAGCCTGGAGAACCTG
GTGCTGCGGCCGGATCCGGAGGCCACCGCGCCGCTGGCCACCGGTCAGGTCCGGATCGAG
GTCCGCGCCGCCGGTCAGAACTTCCGGGACGTGCTCGTCGCGCTCGGCGGCGTGGCGGGT
CAGGAGGGTCTGGGCGGCGAGGGCGCCGGTGTGGTGACCGAGGTCGGGCCGGGGGTCGAG
GGCCTGGCCGTGGGCGACCGGGTGATGGGTCTGTTCCCGCGCTCGTTCGGCCCGCTGGCC
ACCGCGGACGCGCGAACGGTCGCGCCGATCCCCGAGGGGTGGTCGTACGCCACGGCCGCC
GGAGTGCCGGTGGCCTATCTGACGGCGCTGTACGGACTGCGGGACCTGGGCAATGTGCAG
CCGGGTGAGACGGTGCTGGTGCACGCCGCCGCGGGCGGTGTGGGCATGGCCGCCGTCCAG
TTGGCGCGGCACTTCGGCGCCCTCGTGTATGCCACCGCCCATCCGTCGAAGCACCATGTG
CTGACCGCGTTGGGGGTGCCGGAGGGGCATCTGGCGTCCAGCCGCGACCTCGGCTTCGCC
TCGGCGTTTCCCGCGCTGGACGTGGTGCTGAACTCCCTCACCGGCGAGTATGTGGACGCC
TCACTGGGGCTGCTCGGCACCGGTGGCCGCTTCGTGGAGATGGGCAAGAACGACATCCGC
GATCCCGCCGTGGTCGCCGCGGCACATCCCGGTGTGGGCTATCAGGCGTTCGACCTGGGA
GGTGACGCGGGGCCGGACCGGATCCGGGAGTTGCTCACTGAGCTGGTGGAGCTGTTCGAG
GCGGGCCGGATAGAGCCGCTTCCGGTGCGGCAGTGGGACATCACCCGCGCCCCCGAGGCG
TTCCGCTGGATGAGCCAGGGGCGGCACACCGGCAAGATCGTGCTCACCCTCCCCCGCGCC
CTGGACCCGGACGGCACCGTCCTGATCACCGGCGGCACCGGAACCCTCGGCGCCACCGTC
GCCCGCCACCTCGTCACCCAGCACGGCACACGCCGACTACTGCTGGTCAGCCGCCGGGGA
CCGGACGCACCCGGCGCCACCGACCTCACCACCGAACTCACCGAACTCGGCGCCACCGTC
CACATCACCGCATGCGACACCGCCGACCGCGACCAACTCGCCACCACCCTCGCCGACATC
CCGGCCGACCACCCCCTCACCGCCGTCATCCACACGGCCGGGACGCTCGACGACGGCACC
CTCACCGCACTCACCCCGGACCGCCTCGACACCGTCTTCCGCCCCAAGGTCGACGCCATC
ACCCACCTCCACCACCTCACCCACGACCACGACCTGGCCGCCTTCGTCATCTACTCCTCC
GCCGCCGGAACGCTCGGCAACGCGGGCCAGGCCAACTACGCCGCCGCCAACGCCTTCCTC
GACGCCTTCGCCCAGTGGCGGCACGCCCGCCATCGGCCCGCCACCTCGCTGGCGTGGGGG
CTGTGGAGCGACACCAGCACGCTCACCGCGACGATGGACGCCACCGACGTGCGCCGCACA
CGGCGGGCGGGGGTGCTGGGCATGGACAACGCCGAGGCGCTGCGGGTGTTCGACACCGGG
TTGCGGTCCGGGCGGCCCGCGCTGGTGGCAGCGAAGATCGACCTCACCGCCCTGCGCGCG
CCGGACGCCGAGTTGTCGCCGCTGCTGCGCGGTCTTGCCCGCCCGGCGCGCCGCACCGCG
CGGACCGCGGCCCCGGCGGCCGGTGGTCTGTCGGGGCAGTTGGCCGGGCTGTCCCCCGCC
GGGCAGCGGGAGTTCCTGCTCAACCTGGTGCGGGCGGAGGCCGCGGTGGTCCTCGGCCAT
ACCGGGCCTGAGGCGATCGAGCCGACGGTGGCGTTCAAGGAGATGGGCTTCGACTCGCTG
ACGGCGGTCGAACTGCGCAACCGGCTGAATGCGGCGACCGGGCTGCGGCTCCCCGCCACG
TTGCTCTTCGACCACCCGACCCCGGCTCTTCTCACCGAGCTGTTCCACACCGAGCTGGGC
GGCGGCCCGGCACCCGCCGCGGCGGCCCCGGTGACCGTGCGCGCCGCCGCTGACGAGCCG
ATCGCCGTGGTGGCGATGAGCTGCCGTCTGCCGGGCGGAGTGACCGACCCGGACGGGCTG
TGGAACCTGCTGCTCGGAGAGCGCGACGGCATCACCGACTTCCCCCGTGACCGGGGCTGG
GACCTGGAGGCGCTGTTCGACGCCGACCCGGACCGGAGTGGCACCTCCTATGTGCTGCGT
GGCGGGTTCCTCGAGGACGCGGCCGGTTTCGACGCGGACTTCTTCGGCATCTCGCCGCGT
GAGGCGCTGGCGATGGACCCGCAGCAACGGCTGTTCCTGGAAGCCTGCTGGGAGGTGTTC
GAGCGGGCGGGCATGGACCCGACCGCGGTGGGAGGCGGCGACATCGGCGTGTTCGCCGGC
GTCATCAACCAGGACTACGGCGTGCGGAGCGGTCCCGCTCCCGAGGACCTCGAGGGCTAT
ATGCTCACCGGCTCGGCGACGAGTGTCGCCTCCGGCCGGGTGGCCTATGTGCTGGGCCTG
GAGGGCCCGGCGGTCACGGTGGACACGGCGTGCTCCTCCTCACTGGTGGCCATGCACTGG
GCCGTACAGGCATTGCGGCAGGGCGAGTGCTCGATGGCGCTGGCCGGGGGCGCCACGGTG
ATGGGGCGGCCGTCGGCGTTCGTGGAGTTCTCACGCCAGCGCGGCCTGGCGCCGGACGGC
CTGTGCAAGGCGTTCGGGGCGGGTGCGGACGGCACCACCTTCAGCGAGGGTGTCGGGGTA
CTGCTGCTGGAACGGCTCTCGGACGCCCGCCGCAACGGCCACGAGGTGCTGGCCGTGGTC
CGCGGTACGGCGGTGAACCAGGACGGCGCCAGCAACGGCCTCACCGCCCCCAACGGCCCC
TCCCAGCAGCGCGTGATCCGACAGGCACTGGCGAACGCCGGACTGTCGGCCACCGACATC
GACGCCGTCGAAGCACACGGCACCGGCACCGCCCTCGGCGACCCCATAGAAGCCCAGGCA
CTCCTGGCCACCTATGGCCAGGACCGTCCTGGGGACGAGCCCGTATGGCTCGGCTCGCTG
AAGTCGAACACCGGGCACACGCTGGCCGCGGCAGGCGTGTCCAGCGTCATCAAGATGGTG
CTGGCGATGCGGAACGGCACGCTTCCGCGCTCCCTGTACGCCGACGAGCCCACACCGGAA
GTGGATTGGTCCCAGGGCGCGGTGTCCCTGCTCACCGAGGCCCGGCCCTGGCCGGAGACC
GGACACCCCCGCCGCGCCGGAATCTCCTCCTTCGGCATCAGCGGCACCAACGCCCACCTC
ATCCTGGAGCAGGCCCCTCAGCCCGAACCCCAGGCCGAGACCGACCCCGAGCCCGAAGCC
GCGCCGAAGGCGGACGACGGCATGGCCACTCCCGGGCTCGTGGCGACCGGCGGGAGCGTG
CCCTGGGTGCTGTCCGCCAAGACCGCCACGGCCCTGCGGGCTCAGGCTCAACGGCTCCTG
GACCACCTGGAGTCCGGGGTGACCGACCGCCCCCTCGACATCGGCTGGTCCCTGGCCACC
ACCCGCACCCTCCACGACCACCGCGCGGTCATCCTCACCGACACCGAGGGCGCTGACGCC
ACGGCCGCCCTCACCGCCCTCGCGACCGAACAACCCCACCCCCGCCTCACCACCGGCCAC
GCCACCACCCACGGCAAGACCGTGTTCGTGTTCCCCGGCCAGGGCGCCCAATGGGCAGGC
ATGGGAGCCCAACTCCTCGACACCTCACCCGTCTTCGCCACCCGCCTCCACGAATGCGCC
AAAGCTCTCGCCCCCTACACCGACTGGTCACTCATCGACGTCATCACCGGCGCGCCTGAT
GCCCCTTCGCTCGACCGCGTCGACGTCCTCCAGCCCACCACCTTCGCCATCATGGTCTCC
CTCGCCGCACTCTGGCAGGCCAACGGCATCCACCCCGACGCCGTCATCGGCCACTCCCAA
GGCGAAATCGCCGCAGCCTGCGTCGCCGGACACCTCACCCTCACCAACGCCGCCAAAATC
GTCACCCTCCGCAGCCAGACCATCGCCCACCACCTCACCGGACACGGCGCCATGATGTCC
GTCCTCGCATCCCCCACCTGGGTCCAGGAAACACTCGCACCCTGGCACGGACACCTATGG
ATCGCCGCCGTCAACGGCCCCGCATCCGTCTCCGTATCCGGAGACCCCGACGCACTCGCC
GAATTCGGCACCACCCTCTCCAAAGCCAAGGTCTACCGCTGGCAACTCCCCGGCGTCGAC
TTCGCCGGACACTCCGGACACGTCGACACCATCAAAGACCAGTTGCACAACGTACTCGAC
GGCATCACCGCCACACCCGGCCACACCGCCTGGATGTCCACCGTCGACGCCGACTGGGCC
AACCCCACACACATCGACCCCGACTACTGGTACCGCAACCTCCGCGACACCGTCCGCTTC
GAAGAAGCCACCCGAGCCCTCCTCACCCAGGGCTACCGCGTCTTCATCGAGGTCAGCACC
CACCCGGTGCTGACCACCGCCATCCAGGACACCACCGAATCCCTCCCCGATACCCCCACC
ACCATCACCGGCACCCTCCGCCGCGACGACGGCGGCCCCGACCGCGTCCTCACCAGCCTC
GCGGAGCTCTCCGCCGCCGGAATTCCGGTCCACTGGCCCACCGCGTACGCCGGAACCACA
CCCTCCCAAGTTCCGCTGCCCACCTACCCCTTCCAGCACCAGCACTACTGGCTGGCCGCC
ACCGGCCACCACGGGGATGTCGGCTCCGTGGGACTGCGCGACGCGGCGCACCCGCTGCTG
GGGGCCGTGGTCAGCGTGCCGGACACCGGAGGGGTGCTGCTCACCGGGCGGCTGGCACCG
TCGGCGCAGTCCTGGCTGGCCGACCATATGCTGTCCGGCGTCGCCCTGGTGCCGGGTACG
GCGATCGTGGAACTGGCCGTACGGGCCGGGGACGAGACCGGCACACCGGTGTTGGAGGAG
CTGGTCCTCGGCCAGCCGATGCTTCTCCCCGAGGACGGCTCGCTTCAGGTGCAGGTCCTG
GTCGGCGCGGCCGAGGACGATGAGCGCCGTACGGTGCGGGTCTACTCCCGCGGCGACGAG
TCCGAGCCCTGGGTCGAGCACGCCTCCGGCATCCTGTCCGCGCAGGCGCTCATACCTGTC
GAGGCGGAGCGGCAGTGGCCGCCCGCCGGGGCGGAACCCGTTGCCCTGGAGGGCTTCTAC
GACCGCTTGGCCGAGGCAGGCTATGAGTACGGTCCGGTGTTCCGCGGTCTCACCGCGGCG
TGGACGCGCGACGGTGATGTGTTCGCCGAGGTCACCCTCGGCGAGGAGCAGCATGACCTC
GCGCGCCGCTTCGGCATCCATCCGGCGTTGCTGGACGCGGCGCTGCACGCGAGCAACTTC
TGCCCGGGCAACGAGCCCGGCGGCGGGACGTATCTGCCGTTCTCCTGGAACGGTGTGCAG
TTGCACGCCGACGGCGCCACCGCCCTACGAGTGCGGGTCACCTCCACCGGGCCGGACAAC
CTGTCCCTGTACGCGACCGATCCGCACGGGGTGCCCGTGGTGACCGTCGGGTCGCTGGTG
CTCAGGGAGACCACCGCGGAGCAGCTCCGCACCACATCGGCCTCGTCCACCGCGGATTCC
CAGTTCACCGTGGAGTGGACCGAACATGCCCTGGCCCGGGACGAGGTGGCGTGGGCGGCG
CTGGACGCCGTGCCCGACCAGGACACGTGGCCGCCGGTGGTCGTCGCCGACACCCGGGCA
TACACCGCGGAGGGCGGCGAACTACCGGAGCGCGCCCGTGCGCTGACCTGCCGGGCACTG
GCCGCGATACGGCGTCTGATCAGCGACGACGCACTCGCCGACAGCCGTCTGGTGCTGCTC
ACCCGGGGTGGCATGGCGGTGCATGACGACACCGAGGTCACCGACCCGGCCGCCGCCGCG
GTGTGGGGCCTGGTGCGCGCCGCGCAGGCCGAGCACCCGGGCCGGGTGTGCGTGATCGAC
ACCGACGACCGGTCGGCCGAGGCCCTGCCCGCCGCGCTGGCCACGGAGGAACCCCAGCTC
GCGCTGCGTGGCGGAATCGCGTGGGTGCCCCGCCTGGTGCGAGCGCGCCCGGGCCTGGCG
GTCCCGGCCACCGCGGCGTGGCATCTGGACGTCACCGAACACGGCACACTGGAGAACCTC
GCCCTGGTGCCCCACCCTCGGGCGGAGGCGCCGCTGGAGGCGGGCCAGGTGCGGATCGCG
GTACGCGCCGCCGGTCAGAACTTCCGCGATGTGCTCATCGCCCTCGGCATGTACGAGGCG
GAGATCGGCACCGAGGGCGCGGGCGTGGTGACCGAGGTCGGCCCGGGCGTGGCGGATCTG
GCCGTGGGCGACCGTGTGATGGGCATGCTGCCCGGTTCGTTCGGGCCGCTGGTGGTGGCG
GACCGGCGGACGGTGGTGCGGATGCCGCGCGGCTGGTCGTTCACGGCGGCGGCCGGGGTG
CCGGTCGCCTATCTCACCGCGCTGTACGCGTTGCGGGATCTGGGCGATGTCCAGCCGGGC
GAGACGGTGCTGGTGCACGCCGCAGCCGGTGGAGTCGGCATGGCCGCCGTACACCTCGCC
CACCACTTCGGCGCCACCGTCCTCGCCACCGCCCACCCGGCCAAACACCACAGCCTGGAA
CAGCTCGGGGTGGCCACGGAACGGCGCGCCTCCAGCCGCGACCTCGCCTACGCCCACACC
TTCCCGACCACCGATATCGTCCTCAACTCCCTCACCGGCGAACACATCGACGCCTCGCTG
CGGTTGCTCAACCCCGGTGGCCGTTTCATCGAGATGGGACGTACCGACATCCGGGACGTG
GACGAGGTGGCCGCGACGCACCCGGACCGCACCTATCGCGCGTTCGACCTGGGCGCGGAC
GCGGGGCCGGATCGCATCCAGGAACTGCTGGTCGAGCTGGTGGACCTGTTCGAGCAGGGC
CTGATCCCTCCGTTGCCCACCCGGCCGTGGGAGATCACCCGCGCCCCCGACGCGTTCCGC
TGGATGAGCCAGGGCCGCCACACCGGCAAGATCGTGCTCACTCTCCCGCGCACCCCCGAC
CCCGACGGCACCGTACTGATCACCGGCGGCACCGGCACCCTCGGCACTGCCATCGCCCGT
CACCTCGTCACCCACCACGGTGTACGCAACCTGGTCCTCACCGGCCGCCAGGGGCCGAAC
GCCCCCGGCGCGGCCGACCTTCACGACGAACTGACCGCACTGGGCGCACAAGTACGGATC
ACCGCCTGCGACAGCGCCGACCGCGGCCAACTCGCCGCACTCCTCGCCGGCATCCCGTCC
GACCACCCCCTCACCGGCATCGTGCACACCGCCGGCACCCTCGCCGACGGCACCCTCACC
ACACTCGACCCCGACCGCATCGACACCGTCTTCCGCCCCAAGGTCGACGCGGTCACCCAC
CTGCACGACCTCACCCGCGACCAGGACCTGGCCCTCTTCGCCGTGTACTCCTCCGCCGCC
GGAATCCTCGGGAACGCGGGCCAGGCCAACTACGCCGCCGCCAACACCTTCCTCGACGCC
TTCGTACAGCAGCGGCGCGCGGCGGGGCTGGCCGGGCTGTCGCTGGCCTGGGGCCTGTGG
GCGGAGACCAGCGAGCTGTCGGCCGCGCTGATCACGGCCAACCGGGATCGCACCCGACAC
GGTGTCGTCCGCCCGATGACCACCGAGCACGCCCTGAGCCTCTTCGACTCCGCCCTCGGC
CTGGGGCTGCCCCTGGTGGTACCGGCGAAGCTGGACCCCGGCGCACACGAGTCCGCCGCG
GGCGCTGTGTCGCCGCTGCTCACCGGGCTCGTCCGGCCGACCCGACGCACCCTGCGGTCC
ACGTCGGGCCAATCCGGCGAAGGCGGTCTGACGGCCCGGCTGGCGGCGCTGTCCGAGGCC
GATCAGCACCGGCTACTGCTGGACCTGGTACGGGACCATACGGCGACCGTGCTCGGGCAC
ACCGGGAAGGACGCCGTGGACGCCAGGCGCGCGTTCAGCGACATCGGGGTCGACTCGCTC
ATCGCGGTGGAACTGCGCAACCGGCTCGCCGGCGCGACCGGGCTGCGGCTGCCCGCGACG
GTCGTGTTCGACTACGCGACACCGGAGGCGATGGCCGGACATCTGCGGTCCGTGGTGGCC
GGAGACACGGCCGCCCCCGCCTCCCCGTCGACGTCGGCGCCCGCTTCGGCGGTGGCCCCG
GCGGACGACCCGGTGGCCATCGTGTCGATGAACTGCCGACTGCCCGGCAAGGTCACCGGC
CCAGGGGAACTGTGGGATCTGGTGTCCCAGGGCCGGGACGCGATCGGCCCCTTCCCCACG
GACCGCGGCTGGGACGTGGAGACGCTGTTCGACCTCGACCCGGACGCCGTGGGCAAGTCC
TACGTACGCGAGGGCGGTTTCCTCACCGGCGCCGGTGACTTCGACGCCGAGTTCTTCGGC
ATCTCGCCACGCGAGGCGCTGGCGATGGATCCGCAGCAGCGACTGCTCGCCGAGACCTCA
TGGGAGCTGTTCGAGCAGGCGGGCATCGACCCGATGTCCGTGCGCGGACAGGCCATCGGG
GTGTTCGCCGGGGTCATCGACCAGGGATACATCGCCCACTCCGAGGCGCCCCCGCCGGAG
TTGGAGGGCTACCTGATGACCGGCAGCACCACAAGTGTGGCCTCCGGCCGAGTGGCCTAT
CTGCTGGGCCTCGAAGGCCCCGCGGTGACGGTGGACACGGCGTGCTCGTCGTCGCTGGTG
GCGCTGCATCTGGCCGTACAGGCGCTGCGGGCGGGCGAGTGCTCGATGGCCATCACCGGT
GGCGTGACGGTGATCGCCAAGCCCGGCGGTTTCATCAGCTTCTCCCGCCAGCGCGGGCTC
GCGCCGGACGGCCGTAGCAAGTCCTTCAGCGAGGGCGCCGACGGCACCACCTTCAGCGAG
GGCATCGGTCTGGTGCTGCTGGAACGGCTCTCGGACGCCCGCCGCAACGGCCATGAGGTA
CTGGCCGTGATCCGTGGCACCGCGGTGAACCAGGACGGGGCGAGCAACGGCCTCACCGCT
CCGAACGGGCCCTCCCAGCAGCGAGTGATCCGGCAGGCCCTGTCCAACGCCGGGCTCACA
GTGGCCGACGTGGACGCGATCGAGGCACACGGCACCGGCACCGCCCTCGGCGACCCCATC
GAGGCACAGGCACTGCTCGCCACCTACGGCCAGGACCGCCCGGGGGACGAACCCGTGTGG
CTCGGCTCGCTGAAGTCCAACATCGGCCACACGCAGGCCGCCGCGGGCATCGCGGGCCTC
ATCAAGATGGTGCTGGCGATGCGGCATGGCATGCTTCCGCCCTCACTGCACGCCGGCGAG
CCCACCACCAAGGTCGACTGGGCGTCGGGGGCGGTGTCCCTGCTGTCCGAGGCCCGACCC
TGGCCGGAGACGGGACACCCTCGCCGCGCCGGAATCTCGTCCTTCGGCATCAGCGGGACG
AACGCACACGTGATCCTGGAGCAGGGGCCGGAGGTGGCTGTGCCCGAGGCGGAGACGGGC
GCTCCTGGGTTGGTGGCCACAGGCGGTGTGGTGCCGTGGGTGCTGTCCGCCAAGAGCCCT
GCGGGGCTGCGGGCTCAGGCCGAGCGTCTGGTCAGCCACCTGGAATCCGGGGACGCTCCG
CGTGCGGTGGACGTGGGCTGGTCACTGGCCACCACGCGCGCTGCCCTCGATCATCGCGCG
GTCATCCTCGCCACGGATACCGAGCAGGGCACGGCGACCGTCCGTGCCCTGGCGGAGGGA
CGGCCCGACCCGCTCCTGGTCACCGGGCAGACCGGGACGGATGGCAAGACCGTGTTCGTC
TTCCCCGGCCAGGGAGCCCAGTGGGTGGGCATGGGGGCACAACTCCTCAGCACCTCTCCC
GCCTTCGCCACCCGGCTACGCGAGTGTGCCGACGCGCTGGCCCCGTATACCGACTGGTCG
CTCATCGACGTCATCACCGGCGCACCCGATGCCCCTTCGCTCGACCGTGTCGACGTCGTA
CAGCCCGCCACCTTCGCCGTCGTCGTCTCCCTCGCCACCCTCTGGCAATCCATGGGTATC
CACCCCGACGCCGTCACCGGCCACTCCCAAGGCGAAATCGCCGCAGCCTGCGTCGCCGGA
CACCTCACCCTCGACGCCGCCGCCAAAATCGTCGCCCTGCGCAGCCAGATCATCGCCGAC
CACCTCGCCGGACACGGCGGCATGATGTCCGTCCTCGCCTCGCGGGAACAGGTCGAGGAA
GCCCTCACCCCGTGGCAGGGCAAGCTCTGGATCGCCGCGCACAACAGCCCCCAGGCGACC
GTCGTCGCAGGCGACATCGACGCTCTGCACGAACTCCACGCCCACTACACCGACCAGGAC
ATCCGAGCCCGCATCATCCCCGTCGACTACGCCTCCCACACCGGACACGTCGACACCATC
AAGAACGAACTCCACCAAACCCTGGCCGACACCACCACCGAGCCCGGCACCCTCCCCTGG
CTCTCCACCGTCGACGGGGAGTGGATCGAACCCGACACGCTCGACAGCGGCTACTGGTAC
CGGAACCTGCGCCAAACGGTGCAGTTCCACACCGCCATCACCACCCTCGCCGACCAGGGC
TACCGCACCTACATCGAAATCAGCCCCCACCCCGTCCTCACCACCGCCATCCAAGAAACC
CTCGAAGCCAACGACACCTCCAACACCACCATCACCGGAACCCTCCGCCGCGACGACGAC
ACCCCCACCCGCCTCCTCACCAACCTCGCCCACCTCACCACCAACGGCCACACCCCCGAC
TGGACAGCCCTCTACTCCGCCACCCACCCCCACCCCACGCCCCTCCCCACCTACCCCTTC
CAACACCACCACTACTGGCTCACACCGTCCGAGGTGCCGGAGGCGGTGGCCGACGGTGTG
TTCTGGGAGACCGTGGAGCGGGGCGACCTCGCCTCCCTGGCCGATTCCCTCGGCGTCGAG
GAGAAGGCGCTGGAGCCCGTCCTGCCGGGGCTGACGTCGTGGCGGCGCCGCAACCAGGAC
CAGTCCACCGTGGACGCCTGGTCGTATCGCATCGCCTGGGATCCGGTGGCCAGCGGGGAG
GCGCCCGTACTGCCAGGAGCGTGGCTGGTGGCCGTGGCCTCACCGCAGACGAGCGACACC
GCGGTGACGGGCGTGATCGCCGCGCTGGCCGCGCACGGCGCCGATCCCGTGGTGGTCGAG
GTGGACACGGTGGAGCGGGCGGAGGTGACCGCCCTCCTGCGGGAGCGGATGTCGGGTTCC
GATGACGAGTACGCCGGGGTGCTGTCCCTGCTGGCATGGGACGAGCGGACCTGCGAACCC
GGCACGCTCTCCCGGGGCGTGGCGGCCACCGTGGCGCTGATGCAGGCCGTGGAGGAGATC
GGGCTCACCGCTCCCCTGTGGTGCCTGACGCGTGGCGCGGTCGCCGTGCGTGAACCCTCC
GAGGTGACCAGCGAGTTCCAGCCGCTGGCCTGGGGAATGGGCGTGGTGCAGGGGCTGGAT
CAGCCGTCCACCTGGGGTGGGATCGTGGATCTGCCGCGGACGCCGGATGATACGGCCCTT
GCCCGGTTGTGCTCGGTGCTTGCCGGAGTGGACGCGGAGGACCAGGTCGCGGTGCGCGCG
TCGGGGGTGTTCGCCCGGCGGATGCGGCGCGAACCGGTGACGTCGGCACCGGCGTGGCAG
CCACGGGACACGGTGCTGATCACCGGCGGCACCGGCGGACTCGGCTCGTACGTGGCCCGT
TGGGCCGCGGGTCACGGCGCCCGGCGTGTGGTGCTGCTCAGCCGTCAGGGTGCGCAGGCG
GCGGGCGCGGCGGAGCTGGAGGCCGAGCTGACCGCGCTGGGCGCGGACGTGACCATCGCG
GCGTGTGATGTGACCGACCGGGACCAGCTCGCGGCCGTCCTGGCGGAGATTCCGGATGAC
GTGCCGTTGTCGGCCGTGGTCCACGCCGCGGGGCTGGCGCTGCCGGAGAAGCCGCTGTCG
AAGATGACACTCGCCGAGTTCGCCGATATCGGCCGGGCGAAGATCGCCGGTGCGCGGCAC
CTCGACGATCTGCTGGGGGAACGGGAGTTGGACGCCTTCGTCCTGTTCTCGTCCGGAGCG
GCGGCCTGGGGCAGCGGCGGCCAGAGCGCCTACGCCGCCGGCAACGCCTATCTCGACGGG
CTGGCGCAGCGCCGCCGCGCACGGGGGCTGGCGGCCACGTCGGTGGCGTGGGGCGCCTGG
GGTGGCGGCCTTGGCACGATCGACGAGGCGATGGGCGCGCAGTGGCGCCGTACGGGTCTG
ATGACCATGGACCCGCGGCTGGCGGCGCTGGCGATGGCGCACACCGTGGGCAGCGGCACC
GCCCACGGGGTGGTGGCCGACATCGACTGGGAACGGTTCGCCCCCGGCTACACCCTGGCC
CGGTTCCGGCCGCTGCTGCGGGGACTGCCCGATGTCATCGACCTGCTGACCGAGGACACA
CACGAGGACGGCGCGGGACAGACGGAGCTGATCGCACGGCTGGCCGGGCTGAGCCCCGGG
GACCAGGAGCGGCTGCTCACCGAGCTGGTGCAGGCCGAGGCCGCGGCCGTACTCGGACAC
GCGAGCGCCGATGCCACCGGGGACCGTCCGTTCAGCGAGATCGGATTCGACTCGCTGACG
GCGGTGGAGCTGCGCAATCGCCTCAATGCCGGCACGGGGCTGAAGCTGCCCGCGACGATG
GTGTTCGACCACCCGCGGCCCAGTGCGCTGGCGCGCCGTATCCGCACCGAACTCGGCCAG
ACCGACACCTCGTCGGTGGACTCGGTGCTGGCCGAGCTGGAGCGGCTGGAAGCACATTTG
GCGGCGCTGCCGAAGGAGAAGATCGAACGCGCCCGGATCACCTCGCGGCTACAGCGGATG
ACCACCAAGGTCGCCGAGATCGAGGCCAACGGCGCGGGCGGCGAAACCGTCACCGAACGA
CTCGACACGGCGAACGCCGACGACGTGTTCGCCTTCATCGACCAGGAGTTCGGCGTGGAC
TGA
[0] A36..442
[0] PCP997..1067
[1] KS1087..1463
[1] AT1627..1945
[1] methylmalonyl-CoA1817..1821
[1] DH1993..2159
[1] ER2475..2775
[1] KR2785..2965
[1] ACP3062..3136
[2] KS3158..3532
[2] AT3708..4029
[2] methoxymalonyl-ACP3901..3905
[2] DH4077..4237
[2] ER4535..4833
[2] KR4843..5023
[2] ACP5126..5196
[3] KS5223..5598
[3] AT5758..6077
[3] methylmalonyl-CoA5950..5954
[3] KR6383..6563
[3] ACP6662..6735
[0] A106..1326
[0] PCP2989..3201
[1] KS3259..4389
[1] AT4879..5835
[1] methylmalonyl-CoA5449..5463
[1] DH5977..6477
[1] ER7423..8325
[1] KR8353..8895
[1] ACP9184..9408
[2] KS9472..10596
[2] AT11122..12087
[2] methoxymalonyl-ACP11701..11715
[2] DH12229..12711
[2] ER13603..14499
[2] KR14527..15069
[2] ACP15376..15588
[3] KS15667..16794
[3] AT17272..18231
[3] methylmalonyl-CoA17848..17862
[3] KR19147..19689
[3] ACP19984..20205

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [36-442]  6.49999999999992e-109 PF00501
PF00501   AMP-binding
IPR001227 Acyl transferase domain (Domain)
 [1619-1750]  G3DSA:3.40.366.10 [1817-1935]  G3DSA:3.40.366.10 [3698-3831]  G3DSA:3.40.366.10 [3901-4019]  G3DSA:3.40.366.10 [5750-5881]  G3DSA:3.40.366.10 [5950-6068]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [2602-2623]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [3094-3109]  PS00012 [5154-5169]  PS00012 [6693-6708]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [997-1067]  PS50075 [3062-3136]  PS50075 [5126-5196]  PS50075 [6662-6735]  PS50075
PS50075   ACP_DOMAIN
 [997-1071]  4.40000000000003e-81 G3DSA:1.10.1200.10 [3063-3140]  4.40000000000003e-81 G3DSA:1.10.1200.10 [5125-5198]  4.40000000000003e-81 G3DSA:1.10.1200.10 [6666-6740]  4.40000000000003e-81 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [990-1104]  1.79999754022375e-22 SSF47336 [3059-3175]  1.29999924468179e-27 SSF47336 [5119-5239]  1.29999924468179e-24 SSF47336 [6657-6742]  1.99999636034521e-20 SSF47336
SSF47336   ACP_like
 [1001-1066]  1.9e-10 PF00550 [3070-3133]  1.5e-11 PF00550 [5130-5195]  1.3e-08 PF00550 [6670-6734]  3.2e-11 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [2466-2611]  2.60000517657733e-29 SSF50129 [4523-4667]  3.60000433965927e-31 SSF50129
SSF50129   GroES_like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [2495-2550]  3.5e-06 PF08240 [4555-4608]  5.2e-06 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [744-907]  3.2e-22 PF08659 [2785-2964]  6.19999999999994e-62 PF08659 [4843-5022]  1.09999999999999e-60 PF08659 [6384-6562]  1.2e-57 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [1087-1338]  1.5e-92 PF00109 [3158-3409]  6.10000000000004e-91 PF00109 [5223-5473]  2.59999999999995e-90 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [1346-1463]  4.2e-48 PF02801 [3417-3532]  5.10000000000004e-46 PF02801 [5481-5598]  1.09999999999999e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [1627-1945]  3.99999999999998e-101 PF00698 [3708-4029]  2.30000000000004e-99 PF00698 [5758-6077]  1.5e-102 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [1625-1915]  1.3000049540733e-66 SSF52151 [3706-4010]  9.60004130884281e-64 SSF52151 [5756-6059]  4.80002938964646e-67 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [1753-1816]  1.20000117458134e-14 SSF55048 [3834-3900]  2.39999798157265e-13 SSF55048 [5884-5949]  7.49999605851445e-19 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [1090-1350]  G3DSA:3.40.47.10 [1351-1517]  G3DSA:3.40.47.10 [3161-3421]  G3DSA:3.40.47.10 [3422-3589]  G3DSA:3.40.47.10 [5225-5485]  G3DSA:3.40.47.10 [5486-5650]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1080-1516]  4.99996518094122e-101 SSF53901 [3151-3531]  3.699978135861e-100 SSF53901 [5215-5651]  2.19999900980707e-100 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [745-916]  5.40000000000002e-118 G3DSA:3.40.50.720 [2565-2750]  4.69999999999992e-102 G3DSA:3.40.50.720 [2785-2972]  5.40000000000002e-118 G3DSA:3.40.50.720 [4624-4807]  4.69999999999992e-102 G3DSA:3.40.50.720 [4843-5029]  5.40000000000002e-118 G3DSA:3.40.50.720 [6384-6564]  2.20000000000002e-107 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1251-1267]  PS00606 [3322-3338]  PS00606 [5386-5402]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [1629-1926]  1.59998835313644e-117 SM00827 [3710-4010]  8.39998014024973e-114 SM00827 [5760-6059]  9.49996855930963e-122 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [998-1070]  1.39999892049878e-30 SM00823 [3067-3139]  7.90003079443025e-34 SM00823 [5127-5199]  1.89999859865865e-32 SM00823 [6667-6738]  5.50001754266469e-33 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [1993-2159]  9.80000272130214e-77 SM00826 [4077-4237]  6.40004254961849e-79 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [1090-1516]  SM00825 [3161-3587]  SM00825 [5225-5651]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [744-911]  1.39999892049878e-10 SM00822 [2785-2965]  7.90003079443025e-61 SM00822 [4843-5023]  3.39999972437719e-61 SM00822 [6383-6563]  2.1000026783403e-49 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [2475-2775]  SM00829 [4535-4833]  SM00829
SM00829   PKS_ER
IPR020845 AMP-binding, conserved site (Conserved_site)
 [170-181]  PS00455
PS00455   AMP_BINDING
SignalP
 [1-37]  0.066 Signal
Bacteria, Gram-negative   
TMHMM No significant hit