close all open/close all

CDS information : Herb_00200


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction72,719 / 70,662 / - [in whole cluster]
72,719 / 70,662 / - [in contig]
Locationcomplement(70662..72719) [in whole cluster]
complement(70662..72719) [in contig]
TypeCDS
Length2,058 bp (685 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative carbamoyltransferase
Product (GenBank)HbmN
Gene
Gene (GenBank)hbmN
EC number2.1.3.-
Keyword
Note
Note (GenBank)
  • putative carbamoyltransferase; similar to GdmN
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q8KUG9
NITE
Ansam_00230
PmId
[14624546] The post-polyketide synthase modification steps in the biosynthesis of the antitumor agent ansamitocin by Actinosynnema pretiosum. (J Am Chem Soc. , 2003)
[22195559] Dual carbamoylations on the polyketide and glycosyl moiety by asm21 result in extended ansamitocin biosynthesis. (Chem Biol. , 2011)

close this sectionSequence

selected fasta
>putative carbamoyltransferase [HbmN]
MLVLGLNGNFSAADTDVVPQLGEVFFHDSAASLIRDGELVAAVEEERLNRIKKTTKFPLN
AVRECLALAGARPEDVDAVGYYFPENHIDTVLNHLYTEYPRAPLRYSRELIRQRLKEGLG
WDLPDEKLVYVPHHEAHAYSSYLHSGMDSALVLVLDGRGELHSGTVYRAEGTHLEKLADY
PVPKSLGGLYLNATYLLGYGFGDEYKVMGLAPWGNPETYRDTFAKLYTLQDNGEYELHGN
IMVPNLVSPLFYAEGFRPRRKGEPFTQAHRDFAAALQETVEKIVLHILEYWAKTSGQSRL
CFGGGVAHNSSLNGLILKSGLFDEVFVHPASHDAGAGEGAAYAAAASLGTLERPSKRLLS
ASLGPAMGGREQIRARLADWAPLIDVEFPDDAVETAAGLLAEGQVLGWAYGRSEFGPRAL
GHRSIVADARPEENRTRINAMVKKREGFRPFAPVVTAEAARDYFDLSGADGNHEFMSFVV
PVLPERRTELGAVTHVDGTARVQVVSAESGERFHRLVRRFGELTGTPVLLNTSFNNNAEP
IVQSLDDVVTSFLTTDLDVLVVEDCLVRGKPAPDLGVLVPRFRPVTRLVERRTAGPDASA
GARTHEIHLDYDGGPSAKVSPELYELLGAVDGTTTLGDLAKTVGGLSEALATEVFALWEQ
RFLTLAPAGDLPTGHGPADDGARGR
selected fasta
>putative carbamoyltransferase [HbmN]
GTGCTTGTGCTCGGGCTCAACGGCAACTTCTCCGCCGCGGACACCGATGTGGTGCCGCAA
CTCGGCGAGGTGTTCTTTCACGACTCGGCGGCTTCCTTGATCCGCGACGGCGAACTCGTG
GCCGCCGTGGAGGAGGAGCGGCTCAACCGGATCAAGAAGACAACCAAATTTCCCCTCAAC
GCGGTCCGTGAGTGCCTGGCCCTGGCCGGTGCGCGGCCCGAGGACGTCGACGCGGTGGGC
TACTACTTCCCCGAGAACCACATCGACACCGTCCTCAACCACCTCTACACCGAATATCCG
CGGGCCCCCCTGCGCTACTCCCGGGAGCTGATCCGGCAGCGGCTGAAGGAGGGCCTGGGC
TGGGACCTGCCGGACGAGAAGCTGGTGTACGTGCCGCACCACGAGGCGCACGCGTACTCC
TCGTATCTGCACTCCGGCATGGACTCCGCACTGGTCCTGGTGCTGGACGGCCGCGGCGAA
CTGCACTCCGGCACCGTCTACCGCGCCGAGGGCACGCACCTGGAGAAGCTGGCCGACTAC
CCGGTGCCCAAGTCGCTCGGCGGGCTCTATCTGAACGCCACCTATCTGCTCGGCTACGGC
TTCGGCGACGAGTACAAGGTGATGGGCCTGGCCCCCTGGGGCAACCCCGAGACCTACCGC
GACACCTTCGCCAAGCTCTACACCCTCCAGGACAACGGCGAGTACGAGTTGCACGGCAAC
ATCATGGTGCCGAACCTGGTCAGCCCGCTGTTCTACGCCGAGGGCTTCCGGCCGCGCCGC
AAGGGCGAGCCGTTCACCCAGGCCCACCGCGACTTCGCCGCCGCGCTCCAGGAGACGGTC
GAGAAGATCGTGCTGCACATCCTCGAATACTGGGCGAAGACCAGCGGCCAGTCCCGCCTG
TGCTTCGGCGGCGGCGTCGCCCACAACTCCAGCCTCAACGGGCTGATCCTCAAGTCCGGG
CTCTTCGACGAGGTGTTCGTGCACCCCGCCTCGCACGACGCGGGCGCGGGCGAGGGCGCC
GCCTACGCCGCCGCGGCGAGCCTCGGCACGTTGGAGCGGCCGAGCAAACGGCTGCTCAGC
GCGAGTCTCGGCCCGGCAATGGGCGGCCGGGAGCAGATCAGGGCCCGGCTGGCCGACTGG
GCGCCGCTGATCGATGTGGAGTTCCCGGACGACGCCGTGGAGACGGCGGCCGGACTCCTC
GCCGAGGGACAGGTGCTCGGCTGGGCGTACGGCCGCTCCGAGTTCGGCCCCCGCGCCCTG
GGCCACCGCAGCATCGTCGCGGACGCCCGCCCCGAGGAGAACCGGACCCGCATCAACGCG
ATGGTGAAGAAGCGCGAGGGCTTCCGGCCGTTCGCCCCGGTGGTCACGGCCGAAGCCGCC
CGCGACTACTTCGACCTCTCCGGCGCGGACGGCAACCACGAGTTCATGTCCTTCGTGGTG
CCGGTGCTGCCGGAGCGGCGTACGGAACTCGGCGCGGTCACCCACGTGGACGGCACCGCC
CGGGTGCAGGTCGTCTCCGCCGAATCGGGCGAGCGGTTCCACCGCCTGGTGCGGCGGTTC
GGCGAACTGACCGGCACCCCCGTGCTCCTCAACACCTCCTTCAACAACAACGCCGAACCC
ATCGTGCAGAGCCTCGACGACGTGGTCACCAGCTTCCTGACCACCGACCTGGACGTCCTG
GTGGTGGAGGACTGCCTGGTACGCGGCAAACCCGCGCCTGACCTGGGCGTTCTGGTGCCG
CGGTTCCGCCCGGTGACCCGGCTGGTCGAGCGCAGGACGGCCGGTCCGGACGCCTCGGCG
GGAGCCAGGACCCACGAGATCCACCTCGACTACGACGGCGGCCCGTCCGCGAAGGTCTCG
CCCGAGCTGTACGAACTGCTCGGCGCGGTGGACGGCACCACCACCCTCGGGGATCTGGCC
AAGACCGTCGGCGGACTCTCGGAGGCACTGGCCACCGAGGTGTTCGCCCTGTGGGAGCAG
CGGTTCCTCACCCTGGCCCCGGCCGGGGACCTCCCGACGGGCCACGGGCCCGCGGACGAC
GGTGCGCGGGGGCGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003696 Carbamoyltransferase (Family)
 [139-503]  8.80000000000003e-88 PF02543
PF02543   CmcH_NodU
SignalP No significant hit
TMHMM No significant hit