close all open/close all

CDS information : Herb_00210


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction73,893 / 72,781 / - [in whole cluster]
73,893 / 72,781 / - [in contig]
Locationcomplement(72781..73893) [in whole cluster]
complement(72781..73893) [in contig]
TypeCDS
Length1,113 bp (370 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative glyceroyl-ACP biosynthesis protein
putative 1,3-bisphospho-D-glycerate phosphatase/glyceroyltransferase
Product (GenBank)HbmH
Gene
Gene (GenBank)hbmH
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
  • similar to FkbH (methoxymalonyl-ACP biosynthesis pathway protein)
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q1G727
NITE
Oxzol_00080
PmId
[16895402] The bifunctional glyceryl transferase/phosphatase OzmB belonging to the HAD superfamily that diverts 1,3-bisphosphoglycerate into polyketide biosynthesis. (J Am Chem Soc. , 2006)
ACC
Q8KUG4
NITE
Ansam_00180
PmId
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
[17076505] On the biosynthetic origin of methoxymalonyl-acyl carrier protein, the substrate for incorporation of "glycolate" units into ansamitocin and soraphen A. (J Am Chem Soc. , 2006)
ACC
Q9KIE6
NITE
Asco_00080
PmId
[15179529] Engineered biosynthesis of 16-membered macrolides that require methoxymalonyl-ACP precursors in Streptomyces fradiae. (Appl Microbiol Biotechnol. , 2004)

close this sectionSequence

selected fasta
>putative glyceroyl-ACP biosynthesis protein [HbmH]
MTEGKPVSEPPTAVKCLVWDLDNTLWRGTLLEDGEVLPFEWVRDVITTLDERGILQSIAS
KNDHDHAWERLEALGLAEYFVLPHIGWGPKSASVRAIADRLNFADRAMAFVDDQPAERAE
VAYRLPEVRCYPAEDLAGLTGLPEFSPAVVTVDSRQRRNMYQSGFRRDAERAEFSGPDED
FLRTLDIRMGISRATERELSRVEELTLRTSQMNATGVHYPDSVLRGLLTDPAHEVLVITM
ADRFGPHGAVGIVLLERHPAVWHLKLLATSCRVVSFGAGSTLLNWLADQAAQAGVHLAAD
FRRTDRNRMMEVAYRFAGFADTTCACTAALAAPDEEGVERLHLTPAFQPAPTTLRLTAPE
LADPALPRSR
selected fasta
>putative glyceroyl-ACP biosynthesis protein [HbmH]
ATGACGGAGGGGAAGCCCGTGAGCGAGCCGCCGACGGCCGTCAAATGTCTCGTCTGGGAC
CTGGACAACACACTGTGGCGCGGCACCCTGCTCGAGGACGGCGAGGTGCTGCCCTTCGAG
TGGGTGCGCGATGTCATCACCACCCTCGACGAACGCGGCATTCTCCAGTCCATCGCCAGC
AAGAACGACCACGACCACGCCTGGGAGCGCCTGGAGGCCCTCGGCCTCGCCGAGTACTTC
GTACTGCCGCATATCGGCTGGGGCCCCAAGTCCGCGTCGGTACGCGCCATCGCGGACCGG
CTGAACTTCGCCGACCGCGCCATGGCGTTCGTCGACGACCAGCCCGCCGAACGGGCCGAG
GTCGCCTACCGGCTCCCCGAGGTGCGCTGCTACCCGGCCGAGGACCTGGCCGGGCTCACC
GGGCTGCCCGAGTTCAGCCCCGCCGTGGTCACCGTGGACTCCCGGCAGCGCCGGAACATG
TACCAGTCCGGATTCCGCCGTGACGCCGAGCGGGCCGAGTTCAGCGGCCCCGACGAGGAC
TTCCTGCGCACCCTGGACATACGGATGGGCATCTCCCGCGCCACGGAGCGGGAGCTGTCC
CGGGTCGAGGAACTGACCCTGCGCACCAGCCAGATGAACGCCACCGGCGTCCACTACCCC
GACTCCGTACTGCGCGGACTGCTCACCGACCCCGCGCACGAGGTGCTGGTCATCACGATG
GCCGACCGGTTCGGCCCGCACGGCGCCGTCGGCATCGTGCTGCTGGAACGGCACCCCGCG
GTGTGGCATCTGAAACTGCTCGCCACCTCCTGCCGGGTGGTGTCCTTCGGCGCCGGGTCC
ACCCTGCTGAACTGGCTGGCCGATCAGGCGGCACAGGCCGGGGTGCACCTGGCCGCCGAC
TTCCGGCGCACCGATCGCAACCGGATGATGGAGGTGGCCTACCGCTTCGCCGGGTTCGCC
GACACCACCTGCGCGTGCACCGCCGCGCTCGCGGCCCCCGACGAGGAGGGGGTCGAGCGC
CTCCACCTCACCCCCGCGTTCCAGCCGGCCCCGACGACGCTGCGGCTGACGGCGCCTGAG
CTGGCCGACCCGGCGCTGCCGCGCTCCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010033 HAD-superfamily phosphatase, subfamily IIIC (Domain)
 [15-123]  7.90000000000001e-20 TIGR01681
TIGR01681   HAD-SF-IIIC
IPR010037 FkbH domain (Domain)
 [12-321]  1.5e-111 TIGR01686
TIGR01686   FkbH
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [188-296]  1.49999977583352e-06 SSF55729
SSF55729   Acyl_CoA_acyltransferase
 [190-322]  8.3e-07 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
IPR023214 HAD-like domain (Domain)
 [11-115]  2.89999717862184e-15 SSF56784
SSF56784   HAD-like_dom
 [14-116]  5.10000000000001e-10 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   HAD-like_dom
SignalP No significant hit
TMHMM No significant hit