close all open/close all

CDS information : Herb_00220


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction75,002 / 73,890 / - [in whole cluster]
75,002 / 73,890 / - [in contig]
Locationcomplement(73890..75002) [in whole cluster]
complement(73890..75002) [in contig]
TypeCDS
Length1,113 bp (370 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative oxidoreductase
Product (GenBank)HbmI
Gene
Gene (GenBank)hbmI
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
  • similar to FkbI (methoxymalonyl-ACP biosynthesis pathway protein)
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q9KIE5
NITE
Asco_00090
PmId
[14623185] Crystal structure of an Acyl-ACP dehydrogenase from the FK520 polyketide biosynthetic pathway: insights into extender unit biosynthesis. (J Mol Biol. , 2003)
[15179529] Engineered biosynthesis of 16-membered macrolides that require methoxymalonyl-ACP precursors in Streptomyces fradiae. (Appl Microbiol Biotechnol. , 2004)
ACC
Q8KUG3
NITE
Ansam_00170
PmId
[11960423] Identification of a set of genes involved in the formation of the substrate for the incorporation of the unusual "glycolate" chain extension unit in ansamitocin biosynthesis. (J Am Chem Soc. , 2002)
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)

close this sectionSequence

selected fasta
>putative oxidoreductase [HbmI]
MTDAATSHTELVSGLIGDRADAWDLAGELPRDLLVKLGASGVLCAQVGAEHGGAGLDSRA
NGELTAAVGARCSSLRSVMTSQGMAAWTVRRLGGAEQWSTFLPRLTSGDLAAVGFSSPGA
GSDLAAMETEIADDGTHVVVTGRKVWITAAHYADLLVVFGKYRGGAAAVVVPARAPGVSI
TRVPDPLGCRAAGHADITLDAVRVPTGQVLGGTGLPLPLVTTAALTYGRMSVAWGCVGIL
RACLDAAATHTATREQSGRRLAEHQLVARHLAELYVAERHATRACEHASASWDTGSPDMA
VDAVHAKYVASREAADGAARAVQLLASAAASDGHVVARAYRDAKLMEVIEGTSEICQLVL
AQHTRKKVQA
selected fasta
>putative oxidoreductase [HbmI]
GTGACCGACGCCGCCACCAGCCATACGGAGCTGGTCAGCGGGTTGATCGGGGACCGGGCG
GACGCCTGGGACCTGGCCGGGGAGCTGCCCCGCGACCTCCTGGTCAAACTCGGCGCCTCC
GGTGTGCTGTGCGCGCAGGTCGGCGCCGAGCACGGCGGCGCCGGACTGGACAGCCGTGCC
AACGGGGAGCTCACCGCGGCGGTCGGCGCCCGGTGCAGCTCGCTGCGCAGCGTGATGACG
TCCCAGGGCATGGCGGCGTGGACCGTACGGCGGCTGGGTGGCGCGGAACAGTGGTCCACC
TTTCTGCCCCGGCTGACCTCCGGTGATCTGGCGGCGGTCGGATTCAGCAGCCCGGGGGCG
GGCAGCGACCTGGCCGCGATGGAGACCGAGATCGCCGATGACGGCACACACGTGGTCGTC
ACCGGCCGCAAGGTGTGGATCACCGCCGCCCACTACGCCGATCTGCTGGTGGTGTTCGGG
AAATATCGTGGCGGCGCCGCGGCCGTGGTCGTGCCCGCCCGGGCCCCCGGAGTCAGCATC
ACGCGGGTGCCCGACCCGCTGGGCTGCCGCGCCGCCGGCCACGCGGACATCACCCTGGAC
GCCGTCCGGGTGCCCACCGGCCAGGTACTCGGCGGCACCGGACTGCCACTGCCCCTGGTG
ACCACCGCGGCGCTCACCTACGGGCGCATGTCCGTGGCGTGGGGGTGCGTCGGCATCCTG
CGCGCCTGCCTGGACGCCGCCGCCACGCACACCGCCACCCGGGAACAGTCCGGCCGCAGA
CTCGCCGAGCACCAGTTGGTGGCCCGGCACCTGGCCGAGCTGTACGTCGCGGAGCGGCAC
GCCACCCGGGCCTGCGAACACGCCAGCGCCTCCTGGGACACCGGCTCGCCCGATATGGCG
GTCGACGCGGTGCACGCGAAGTACGTCGCGTCCCGCGAGGCGGCCGACGGCGCGGCACGC
GCCGTACAGCTCCTGGCGTCGGCCGCCGCATCCGACGGCCATGTGGTGGCCCGGGCGTAC
CGCGACGCGAAGCTGATGGAAGTCATCGAGGGCACCAGCGAGATCTGCCAGCTCGTCCTC
GCCCAGCACACGCGGAAGAAGGTGCAAGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006090 Acyl-CoA oxidase/dehydrogenase, type 1 (Domain)
 [220-363]  3.39999999999999e-29 PF00441
PF00441   Acyl-CoA_dh_1
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [112-161]  2.6e-12 PF02770
PF02770   Acyl-CoA_dh_M
 [112-203]  6.19999999999999e-26 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [18-109]  9.10000000000001e-12 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [216-368]  3.49999466863949e-30 SSF47203
SSF47203   AcylCoADH_C_like
 [204-366]  8.1e-35 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [12-214]  8.20001307135067e-50 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [15-109]  5.40000000000002e-23 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP
 [1-22]  0.156 Signal
Bacteria, Gram-positive   
 [1-45]  0.065 Signal
Bacteria, Gram-negative   
TMHMM No significant hit