close all open/close all

CDS information : Herb_00230


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction75,274 / 74,999 / - [in whole cluster]
75,274 / 74,999 / - [in contig]
Locationcomplement(74999..75274) [in whole cluster]
complement(74999..75274) [in contig]
TypeCDS
Length276 bp (91 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acyl carrier protein
Product (GenBank)HbmJ
Gene
Gene (GenBank)hbmJ
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
  • similar to FkbJ (ACP in methoxymalonyl-ACP biosynthesis pathway)
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q8KUG2
NITE
Ansam_00160
PmId
[11960423] Identification of a set of genes involved in the formation of the substrate for the incorporation of the unusual "glycolate" chain extension unit in ansamitocin biosynthesis. (J Am Chem Soc. , 2002)
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
ACC
Q9KIE4
NITE
Asco_00100
PmId
[15179529] Engineered biosynthesis of 16-membered macrolides that require methoxymalonyl-ACP precursors in Streptomyces fradiae. (Appl Microbiol Biotechnol. , 2004)
Family/Domain
FD
IPR009081

close this sectionSequence

selected fasta
>putative acyl carrier protein [HbmJ]
MTISSEPGSHTAETVAQEVQQFLEQRTKQTWDPDTDLFSSGAVSSMFAMELVVHLESTFD
VVITGPDLALDNFRTVNAMTAMVLRLRGVQP
selected fasta
>putative acyl carrier protein [HbmJ]
GTGACCATCTCATCCGAGCCGGGCAGCCACACCGCCGAGACGGTGGCGCAGGAGGTGCAG
CAGTTCCTCGAACAGCGCACCAAGCAGACCTGGGACCCGGACACCGATCTGTTCAGCTCC
GGTGCCGTGTCCTCGATGTTCGCCATGGAGCTGGTCGTGCACCTGGAGTCGACCTTCGAC
GTGGTGATCACCGGCCCCGACCTGGCGCTGGACAACTTCCGCACGGTCAACGCGATGACC
GCGATGGTCCTGCGGCTGCGCGGGGTACAGCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [7-87]  3.0999994589937e-12 SSF47336
SSF47336   ACP_like
 [14-83]  4.9e-08 PF00550
PF00550   PP-binding
 [13-85]  1.3e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
SignalP No significant hit
TMHMM No significant hit