close all open/close all

CDS information : Herb_00250


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction76,381 / 77,037 / + [in whole cluster]
76,381 / 77,037 / + [in contig]
Location76381..77037 [in whole cluster]
76381..77037 [in contig]
TypeCDS
Length657 bp (218 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative O-methyltransferase
Product (GenBank)HbmG
Gene
Gene (GenBank)hbmG
EC number2.1.1.-
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
  • OMT; similar to FkbG (putative O-methyltransferase in methoxymalonyl-ACP biosynthesis)
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q8KUG5
NITE
Ansam_00190
PmId
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
ACC
P28034
PmId
[1894629] Molecular cloning, induction and taxonomic distribution of caffeoyl-CoA 3-O-methyltransferase, an enzyme involved in disease resistance. (J Biol Chem. , 1991)
[9037150] Structure of the parsley caffeoyl-CoA O-methyltransferase gene, harbouring a novel elicitor responsive cis-acting element. (Plant Mol Biol. , 1997)
ACC
Q9KIE7
NITE
Asco_00070
PmId
[15179529] Engineered biosynthesis of 16-membered macrolides that require methoxymalonyl-ACP precursors in Streptomyces fradiae. (Appl Microbiol Biotechnol. , 2004)

close this sectionSequence

selected fasta
>putative O-methyltransferase [HbmG]
MAQQVDVTEKILGYVRELSLRDDEILAGLRAETAGLPAAQAMQVMPEEGQLLGLLVRLVG
ARSVLEIGTFTGYSTLCMARALPTDGTLVTCDITAKWPGLGRPFWERAEVADRIDVRIGD
AKETLAGLRREGREFDLVFIDADKTGYAHYYEESLAMLRRGGLIVLDNTLFFGRVTDPAA
QDADTAALREVNKLLREDGRVEISMLTVGDGITLAVKR
selected fasta
>putative O-methyltransferase [HbmG]
ATGGCTCAGCAAGTCGATGTGACCGAAAAAATTCTCGGATATGTCCGGGAACTGTCCCTG
CGCGATGACGAGATCCTGGCCGGGCTGCGGGCGGAGACCGCGGGTCTGCCCGCCGCCCAG
GCCATGCAGGTGATGCCCGAGGAGGGCCAGCTCCTCGGGCTGCTGGTACGGCTCGTCGGC
GCCCGTTCGGTGTTGGAGATCGGCACCTTCACCGGTTACAGCACGCTGTGCATGGCGCGG
GCCCTGCCGACCGACGGCACGCTGGTGACCTGCGACATCACGGCGAAGTGGCCGGGGCTC
GGCCGCCCGTTCTGGGAGCGCGCCGAGGTGGCGGACCGCATCGACGTGCGCATCGGTGAC
GCCAAGGAGACGCTCGCCGGGCTGCGGCGGGAGGGCCGGGAGTTCGACCTGGTCTTCATC
GACGCGGACAAGACCGGATACGCGCACTATTACGAGGAGTCGCTGGCGATGCTCCGGCGC
GGCGGGCTCATCGTCCTGGACAACACCCTCTTCTTCGGCCGGGTGACCGACCCCGCCGCG
CAGGACGCCGACACCGCCGCCCTGCGCGAGGTGAACAAGCTGCTCCGGGAGGACGGACGC
GTCGAGATCAGCATGCTCACCGTTGGTGATGGCATCACGCTCGCGGTCAAACGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002935 O-methyltransferase, family 3 (Family)
 [17-217]  1.29999999999998e-80 PF01596
PF01596   Methyltransf_3
SignalP No significant hit
TMHMM No significant hit