close all open/close all

CDS information : Herb_00260


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction79,917 / 77,137 / - [in whole cluster]
79,917 / 77,137 / - [in contig]
Locationcomplement(77137..79917) [in whole cluster]
complement(77137..79917) [in contig]
TypeCDS
Length2,781 bp (926 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)HbmRII
Gene
Gene (GenBank)hbmRII
EC number
Keyword
Note
Note (GenBank)
  • putative transcriptional regulator; LuxR-type
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q06BL5
NITE
Gelda_00100
PmId
[18214443] The LuxR family members GdmRI and GdmRII are positive regulators of geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Arch Microbiol. , 2008)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [HbmRII]
MPYSYAMPVNTERNSRPLGGVLNTAVHLGHPFGDSLVRPGEALLVDGPLACGKTTLLRSF
AERASESGYLTITATCSPSERDLPFGVVSQLARGAWKSPGGPPEVPGLPDILRGAGDPVD
RAGIARLCHRLCTSLIDHAEHTPLLLAVDDVRHSDPASAAFLLQLVRRLDSARIAAVFTD
DLSLSSSLPLRYELLRAQHLRRIGLGPLSPGQVAEVVVAELGETARRHVGDILAATGGNR
LLLHTLLSDYREYGEARQTGYGQSFLSCLHRNEPIFLDVVRALAVVGSALPAADLAWLTG
HEPEPISQVLAALTGAGLMDEGAFRQETARLSVLNDMPAQARRTLHQRAARLLHDQGRPA
ATIARHLVRAGQIPDSWSAEVLLEVAEQVAVGEEASIAVDLLEQSFEQCPHEERRAALRA
KLAEAEWKINPSTATRHHAPLYGAVRAGRLGLPDSVTLLMQLLWKGGLSEVEGLLAHLRA
DPAATDQLHAIEAALTCTYPWLAERRAAPPHHGGAAATRAAAWPRAGTVLADVLTGGQTH
DTVRRAEEVLRELQLGHDPACHEQAGLFALLALVYGGRNDLASAWCEGALGETGGGPHVP
MRQAVLSAARSEIALRRGDLAEAAEQSRAALTHASPGAWGVAIGLPLGALILACTRMGRH
EEAGFHVAQTVPNAMFKSSYGLHYLYARGHYFLAAGRHQAALADFLLCGELLTDWGLSSG
CDPVPWRIGAAEAWLAQGNHDQARILVYQQLSRPHTDGARARGQSLRLLAATSSAKRRPQ
LLNEAVGLFTEQEDKYELARTLWDLSQAYHALGEKKQARRTMRRAWHVAKMCDAASLYEE
WLPADDQGHATGPTPKSDTAIERLTHSERRVASLAAMGYTNREIAGKLYVTASTVEQHLT
RVFRKLDIKHREQLPTELYADRMELA
selected fasta
>putative LuxR family transcriptional regulator [HbmRII]
ATGCCCTACAGCTATGCCATGCCGGTGAATACCGAGCGGAATTCCCGTCCGCTGGGCGGG
GTATTGAATACCGCGGTGCACCTCGGACATCCATTCGGTGACTCTTTGGTGCGGCCCGGG
GAGGCTCTTCTCGTGGACGGACCGCTGGCATGCGGGAAGACGACCCTGCTCCGGTCGTTC
GCCGAACGAGCCTCGGAATCCGGCTATCTCACCATCACCGCGACATGCTCCCCCAGCGAG
CGGGACCTTCCCTTCGGCGTCGTCTCGCAATTGGCCCGCGGCGCCTGGAAGTCACCGGGT
GGGCCGCCCGAGGTACCGGGGCTGCCGGACATCCTCCGCGGGGCCGGCGATCCGGTGGAC
CGGGCCGGGATCGCCCGGCTGTGCCACCGGCTGTGCACCTCGCTGATCGACCACGCGGAA
CACACACCACTGCTCCTCGCCGTGGACGATGTCCGGCACAGCGACCCGGCCTCCGCAGCC
TTCCTCCTGCAACTGGTACGGCGCCTGGACTCGGCGCGCATCGCGGCCGTATTCACCGAC
GACCTGAGCCTGTCCTCGTCCCTGCCGCTCCGCTACGAACTGCTGCGCGCCCAGCACCTG
CGCCGCATCGGCCTGGGCCCCCTTTCCCCGGGTCAGGTGGCCGAAGTGGTCGTGGCGGAG
CTGGGGGAGACCGCGCGCCGCCACGTCGGCGACATCCTCGCCGCCACCGGTGGCAACCGG
CTGCTGCTGCACACCTTGCTCTCCGACTACCGTGAGTACGGCGAGGCCCGCCAGACCGGC
TACGGCCAGTCCTTCCTGAGCTGTCTGCACCGCAATGAGCCGATCTTCCTGGACGTGGTG
CGCGCGCTGGCCGTGGTGGGCTCCGCCCTGCCCGCCGCCGACCTCGCCTGGCTGACCGGA
CACGAGCCCGAGCCCATCAGCCAGGTGCTCGCGGCGCTGACCGGGGCCGGGCTGATGGAC
GAGGGCGCGTTCCGGCAGGAGACGGCCCGGCTGAGCGTGCTCAACGACATGCCCGCGCAG
GCCCGCAGGACCCTGCACCAGCGGGCCGCGCGGCTGCTGCACGACCAGGGCAGGCCCGCC
GCCACGATCGCCCGTCATCTGGTGCGGGCCGGGCAGATCCCCGACTCGTGGTCGGCCGAG
GTGCTTCTGGAAGTGGCCGAGCAGGTGGCGGTGGGCGAAGAGGCGTCCATCGCCGTCGAC
TTACTGGAGCAGTCCTTCGAGCAATGCCCGCACGAAGAGCGCCGCGCCGCCCTGCGGGCG
AAGCTCGCCGAGGCGGAGTGGAAGATCAATCCGTCCACCGCCACGCGGCACCACGCACCG
CTGTACGGCGCCGTCCGGGCCGGCCGGCTCGGCCTCCCCGACAGCGTCACCCTGCTCATG
CAGCTCCTGTGGAAGGGGGGACTGAGCGAGGTGGAGGGGCTGCTCGCCCATCTGCGCGCG
GACCCCGCGGCCACCGACCAGCTCCATGCCATCGAGGCGGCACTCACCTGCACCTATCCC
TGGCTGGCCGAGCGGCGGGCGGCACCGCCGCACCACGGTGGCGCCGCGGCGACACGGGCG
GCGGCGTGGCCCCGGGCCGGTACGGTCCTGGCCGACGTGCTCACCGGCGGGCAGACCCAT
GACACCGTCCGCCGGGCCGAGGAGGTGCTGCGCGAACTTCAGCTCGGACACGACCCGGCC
TGCCATGAGCAGGCGGGGCTGTTCGCCCTGCTCGCCCTGGTCTACGGCGGCCGGAACGAC
CTGGCGTCCGCCTGGTGCGAGGGTGCGCTCGGCGAGACCGGTGGTGGACCGCACGTCCCG
ATGCGGCAGGCGGTGCTGTCGGCCGCCAGGTCGGAGATCGCACTGCGCCGCGGTGACCTA
GCCGAGGCCGCGGAGCAGTCCCGCGCCGCCCTCACCCACGCCTCCCCCGGCGCCTGGGGC
GTCGCCATCGGACTGCCGCTCGGCGCCCTCATCCTGGCGTGTACGCGGATGGGGCGGCAC
GAGGAGGCGGGGTTCCATGTCGCGCAGACCGTGCCCAACGCCATGTTCAAAAGCTCCTAC
GGGCTGCACTACCTGTACGCGCGCGGCCACTACTTCCTGGCGGCGGGCCGCCACCAGGCC
GCGCTCGCGGACTTCCTGCTCTGCGGCGAACTGCTCACCGACTGGGGGCTGAGCAGCGGC
TGCGACCCGGTGCCGTGGCGGATCGGGGCGGCGGAGGCATGGCTGGCGCAGGGCAACCAC
GACCAGGCCCGGATCCTGGTGTACCAGCAGCTCAGCCGTCCGCACACGGACGGCGCCCGG
GCCCGCGGACAGTCGTTACGCCTTCTGGCGGCCACCAGTTCGGCCAAGCGGCGGCCGCAG
TTGCTCAACGAGGCGGTGGGCCTGTTCACCGAGCAGGAGGACAAGTACGAGCTGGCCCGC
ACCCTGTGGGACCTCAGCCAGGCGTACCACGCGCTCGGCGAGAAGAAGCAGGCCCGCCGG
ACCATGCGCCGGGCCTGGCATGTGGCGAAGATGTGCGACGCGGCGTCGCTGTACGAGGAG
TGGCTGCCGGCCGACGACCAGGGCCATGCCACCGGGCCAACGCCGAAGTCGGACACCGCG
ATCGAGCGGCTGACACACTCCGAACGGCGGGTCGCGTCGCTGGCCGCCATGGGCTATACC
AACCGGGAGATCGCCGGGAAGCTGTACGTCACGGCCAGCACGGTGGAGCAGCATCTGACC
CGGGTGTTCCGCAAGCTGGACATCAAGCACCGGGAGCAACTGCCGACCGAACTGTACGCC
GACCGGATGGAGTTGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [864-878]  7.30000590915208e-09 PR00038 [878-894]  7.30000590915208e-09 PR00038 [894-906]  7.30000590915208e-09 PR00038
PR00038   HTHLUXR
 [878-905]  PS00622
PS00622   HTH_LUXR_1
 [857-922]  PS50043
PS50043   HTH_LUXR_2
 [862-914]  3.7e-11 PF00196
PF00196   GerE
 [861-918]  4.00000300869883e-20 SM00421
SM00421   HTH_LUXR
IPR011990 Tetratricopeptide-like helical (Domain)
 [685-871]  4.80000000000001e-14 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [872-914]  1.6e-17 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [842-923]  6.00000361638163e-15 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit