close all open/close all

CDS information : Herb_00280


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction81,528 / 81,334 / - [in whole cluster]
81,528 / 81,334 / - [in contig]
Locationcomplement(81334..81528) [in whole cluster]
complement(81334..81528) [in contig]
TypeCDS
Length195 bp (64 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.5 electron carrier
Productputative ferredoxin
Product (GenBank)HbmFdx
Gene
Gene (GenBank)hbmFdx
EC number
Keyword
Note
Note (GenBank)
  • ferredoxin
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
P18325
PmId
[1846297] Ferredoxins from two sulfonylurea herbicide monooxygenase systems in Streptomyces griseolus. (Biochemistry. , 1991)

close this sectionSequence

selected fasta
>putative ferredoxin [HbmFdx]
MKVSVDQDKCCAAGHCALAAPEVFDQREEDGTVVLLDARPPLELRDSVAEASFLCPAAAI
AVED
selected fasta
>putative ferredoxin [HbmFdx]
GTGAAGGTCTCGGTGGATCAGGACAAGTGCTGCGCGGCCGGGCATTGCGCGCTGGCGGCG
CCGGAGGTTTTCGACCAGCGGGAGGAGGACGGGACCGTGGTCCTGCTGGATGCGCGGCCG
CCGCTCGAGCTGCGCGACAGCGTCGCCGAGGCGTCGTTCCTCTGCCCGGCCGCCGCGATC
GCGGTCGAGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001080 3Fe-4S ferredoxin (Family)
 [5-16]  1.60000065022528e-06 PR00352 [16-26]  1.60000065022528e-06 PR00352 [48-60]  1.60000065022528e-06 PR00352
PR00352   3FE4SFRDOXIN
SignalP No significant hit
TMHMM No significant hit