close all open/close all

CDS information : Herb_00290


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction82,764 / 81,571 / - [in whole cluster]
82,764 / 81,571 / - [in contig]
Locationcomplement(81571..82764) [in whole cluster]
complement(81571..82764) [in contig]
TypeCDS
Length1,194 bp (397 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)HbmP
Gene
Gene (GenBank)hbmP
EC number
Keyword
  • C-4,5 desaturation
Note
Note (GenBank)
  • P450 (PikC subfamily)
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q06BL3
NITE
Gelda_00120
PmId
[21979086] Novel 4,5-dihydro-thiazinogeldanamycin in a gdmP mutant strain of Streptomyces hygroscopicus 17997. (Biosci Biotechnol Biochem. , 2011)
[22849774] Identification of 4,5-dihydro-4-hydroxygeldanamycins as shunt products of geldanamycin biosynthesis. (J Nat Prod. , 2012)
[23656556] 19-[(1'S,4'R)-4'-Hydroxy-1'-methoxy-2'-oxopentyl]geldanamycin, a natural geldanamycin analogue from Streptomyces hygroscopicus 17997. (J Nat Prod. , 2013)

close this sectionSequence

selected fasta
>putative cytochrome P450 [HbmP]
MDEIRDYPELRAAACPFSPPPGYEELRERSAVTRVRMWDGSTPFLVTGYHEARAALGDSR
FSADGTHKAMPRFVKFEVPAEVFNLGRMDDPEHARIRRMLTANFTIRRTEAMRPMIQGIV
DGLLDRLIAQGPPADLVADFAFPLPSQVIGVMLGVSDADFAEFQQASQGVMDFTASAEEM
GAALGVMVDYVTRMCAAKRADPGDDLLSRLIVDQEPTGGLTQQQVVATALVLLLAGHETT
ANMIALSTVLLLNHPDQLARLRADAGLMGNAVDELLRYITIVQEGTGRVAVEDVEVGGVL
IPAGEGVIINLPSANRDPHFADAHELDLSRPNAREHVAFGFGVHQCLGQTLARVELQIAL
ETLLRRLPTLRLEVPLEDLAFLYESMNFGVARVPVAW
selected fasta
>putative cytochrome P450 [HbmP]
ATGGACGAGATACGCGACTACCCCGAATTGCGGGCTGCTGCATGCCCGTTCTCACCCCCG
CCGGGATACGAGGAACTGCGCGAGCGGTCCGCCGTCACGCGGGTGCGGATGTGGGACGGC
AGCACCCCGTTTCTCGTCACCGGCTATCACGAGGCGCGGGCGGCGCTCGGCGACAGCAGG
TTCAGCGCCGACGGCACGCACAAGGCGATGCCCCGCTTTGTGAAGTTCGAGGTGCCGGCC
GAGGTGTTCAACCTCGGGAGGATGGACGATCCGGAGCACGCCCGGATCCGCCGCATGCTC
ACCGCGAACTTCACCATCCGGCGCACCGAGGCGATGCGGCCGATGATCCAGGGCATCGTC
GACGGCCTCCTGGACCGGCTGATCGCCCAGGGCCCGCCGGCCGACCTGGTGGCCGACTTC
GCCTTCCCCCTGCCGTCCCAGGTGATCGGCGTGATGCTGGGGGTCTCGGACGCCGACTTC
GCGGAGTTCCAGCAGGCGTCGCAGGGCGTCATGGACTTCACCGCGTCGGCCGAGGAGATG
GGCGCCGCGCTCGGCGTCATGGTGGACTACGTGACCCGGATGTGCGCGGCCAAGCGCGCC
GACCCGGGCGACGATCTGCTCAGCCGGCTCATCGTCGACCAGGAGCCGACGGGCGGGCTC
ACCCAGCAGCAGGTGGTCGCCACCGCCCTGGTGCTGCTGCTGGCCGGGCACGAGACCACC
GCCAACATGATCGCCCTGTCCACCGTCCTGCTGCTGAACCACCCCGACCAGCTCGCCCGG
CTGCGGGCCGATGCCGGGCTGATGGGCAACGCGGTGGACGAACTGCTCCGGTACATCACG
ATCGTCCAGGAAGGCACCGGACGGGTGGCCGTCGAGGACGTCGAGGTGGGCGGCGTACTC
ATCCCGGCCGGTGAAGGGGTGATCATCAACCTGCCCAGCGCCAACCGGGACCCCCACTTC
GCGGACGCCCACGAGCTGGACCTGAGCCGGCCCAACGCCCGCGAGCATGTCGCGTTCGGC
TTCGGCGTGCACCAGTGCCTGGGGCAGACCCTCGCCCGGGTCGAGCTCCAGATCGCTCTG
GAGACCCTGCTGCGCCGGCTGCCCACGCTGCGCCTGGAGGTCCCGCTCGAGGACCTGGCG
TTTCTGTACGAGTCGATGAACTTCGGCGTCGCCCGTGTGCCCGTCGCCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [14-397]  2.19999900980707e-94 SSF48264
SSF48264   Cytochrome_P450
 [235-252]  2.19999900980708e-07 PR00385 [270-281]  2.19999900980708e-07 PR00385 [337-346]  2.19999900980708e-07 PR00385 [346-357]  2.19999900980708e-07 PR00385
PR00385   P450
 [17-397]  1e-101 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [204-367]  4.00000000000001e-27 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [88-99]  3.80000697093588e-49 PR00359 [135-151]  3.80000697093588e-49 PR00359 [152-167]  3.80000697093588e-49 PR00359 [189-211]  3.80000697093588e-49 PR00359 [270-281]  3.80000697093588e-49 PR00359 [288-315]  3.80000697093588e-49 PR00359 [337-346]  3.80000697093588e-49 PR00359 [346-357]  3.80000697093588e-49 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [339-348]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit