close all open/close all
first first   Indano_00020 Indano_00020

CDS information : Indano_00010


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction190 / 954 / + [in whole cluster]
190 / 954 / + [in contig]
Location190..954 [in whole cluster]
190..954 [in contig]
TypeCDS
Length765 bp (254 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative hydrolase
Product (GenBank)metallo beta lactamase family protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in indanomycin biosynthesis.
Note (GenBank)
  • Orf1
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)
Family/Domain
FD
IPR001279

close this sectionSequence

selected fasta
>putative hydrolase [metallo beta lactamase family protein]
MGELNQVADGVWVRQSEWVWTNSIVVRGEDGLILIDPGIDGSELNLLADDVDRLGIPVVA
GFCTHPHWDHLLWHPRFGDVPRYATPSAAHLAGQARERARAMAAESASGVPLDLVALVTP
LPADGGRMPGEIIEHRAHAVGHAAVLLADRGVLLAGDMLSDVLIPLFDFRQDDQVGAYEA
ALDRLDEAVGHVHVVVPGHGAVAEGPEVAARLAADRAYVDALRRGAEPVDARLGPHADWL
LGPHRSNLEQARGR
selected fasta
>putative hydrolase [metallo beta lactamase family protein]
ATGGGCGAGCTGAATCAGGTGGCCGACGGAGTCTGGGTCCGTCAGAGCGAGTGGGTGTGG
ACCAATTCCATCGTGGTGCGCGGAGAGGACGGGCTGATCCTCATCGATCCCGGCATCGAC
GGCTCCGAGTTGAACCTGCTCGCCGATGACGTGGACCGGCTCGGCATTCCGGTGGTCGCC
GGGTTCTGCACTCATCCCCACTGGGACCACCTGCTCTGGCATCCCCGGTTCGGCGACGTT
CCGCGCTACGCCACCCCCTCCGCCGCCCACCTTGCCGGTCAGGCCCGAGAGCGGGCGCGG
GCGATGGCGGCGGAGAGCGCGTCCGGCGTCCCCCTCGACCTGGTCGCGCTGGTCACCCCG
CTGCCCGCGGACGGCGGACGGATGCCGGGCGAGATCATCGAGCACCGGGCGCACGCTGTC
GGCCACGCCGCGGTCCTCCTCGCGGACCGTGGCGTCCTGCTCGCCGGCGACATGCTCTCC
GACGTCCTGATCCCGCTCTTCGACTTCCGCCAAGACGATCAGGTGGGAGCCTACGAGGCC
GCACTCGACCGGCTGGATGAGGCGGTCGGTCACGTCCATGTAGTGGTCCCCGGCCACGGA
GCCGTTGCCGAAGGCCCCGAGGTGGCGGCGCGTCTCGCCGCCGATCGTGCCTACGTCGAC
GCGCTCCGGCGGGGAGCGGAACCGGTCGACGCGCGTCTGGGACCGCACGCGGACTGGCTC
CTCGGCCCCCACCGGTCGAACCTTGAACAGGCCCGAGGGCGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001279 Beta-lactamase-like (Domain)
 [21-199]  9.40000000000003e-16 PF00753
PF00753   Lactamase_B
 [20-199]  4.00000300869883e-14 SM00849
SM00849   Lactamase_B
SignalP No significant hit
TMHMM No significant hit
first first   Indano_00020 Indano_00020