close all open/close all

CDS information : Indano_00020


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction1,616 / 1,861 / + [in whole cluster]
1,616 / 1,861 / + [in contig]
Location1616..1861 [in whole cluster]
1616..1861 [in contig]
TypeCDS
Length246 bp (81 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in indanomycin biosynthesis.
Note (GenBank)
  • Orf2
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MTDVRVTYDKTVNAAYIYLTEPQARVKSAHMYPCDPVDVDGMINLDFDDQGRLIGIEVLA
ASSKLPEYLIRSAERLDTEGA
selected fasta
>hypothetical protein [hypothetical protein]
GTGACAGACGTCAGAGTCACCTACGACAAGACCGTGAACGCAGCGTACATATACCTCACC
GAACCGCAGGCCCGCGTGAAGTCCGCGCACATGTACCCCTGCGATCCGGTGGACGTCGAC
GGCATGATCAACCTCGACTTCGACGACCAGGGCCGCCTCATCGGCATCGAGGTGCTGGCG
GCCAGTTCAAAACTGCCCGAGTACCTGATCCGGTCCGCGGAGCGGCTGGACACCGAGGGT
GCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019270 Protein of unknown function DUF2283 (Family)
 [5-62]  3.39999999999999e-19 PF10049
PF10049   DUF2283
SignalP No significant hit
TMHMM No significant hit