close all open/close all

CDS information : Indano_00030


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction3,240 / 1,951 / - [in whole cluster]
3,240 / 1,951 / - [in contig]
Locationcomplement(1951..3240) [in whole cluster]
complement(1951..3240) [in contig]
TypeCDS
Length1,290 bp (429 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative penicillin-binding protein
Product (GenBank)putative penicillin binding protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in indanomycin biosynthesis.
Note (GenBank)
  • Orf3
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)
Related Reference
ACC
Q9L656
PmId
[11094280] Cloning and characterization of the gene encoding penicillin-binding protein A of Streptomyces griseus. (FEMS Microbiol Lett. , 2000)
Family/Domain
FD
IPR001460

close this sectionSequence

selected fasta
>putative penicillin-binding protein [putative penicillin binding protein]
MTSGCSQDTHTGTGDGSPAEHASPSASRRGLGDILVGGKAVTGSQPTNLPKAPYQRTYTD
GPLYAPVTGYRSMAYGRAGLEALYDDSLSAGAQGDVATTIEPAVQKAAFDALGDRQGAAV
ALDAESGRLLTLVSTPSYDPGQFSGRGVKDAQAWRSATADSRSPMLNRALKQADAPGATF
SVVVAAAALDEGLYATVDDATVSPLTYVLPLSTTRVTGASSQCENASIGLALHRSCANVF
TKLAAELGQDRLRAAARKFGFDDDTLKVPLTVAESSYPGDGTTAPEAALTGMGAGDVRAT
PLQMARVAAAVANGGRLVSPRLVEGVTKADGTTQLPEAADAGSAGQAMSRGTAEALRAAL
GSGGQAGWVPSGDGDLAASWFIGSAPSGDGRRVAVAVRVEGLPSTAGAEESAGGRAAAEA
AEKILASVS
selected fasta
>putative penicillin-binding protein [putative penicillin binding protein]
GTGACCAGCGGCTGCAGCCAGGACACGCACACCGGCACCGGGGACGGGTCCCCGGCGGAG
CACGCCTCCCCGTCCGCGTCCAGACGCGGACTGGGCGACATTCTCGTCGGCGGGAAAGCC
GTCACCGGCTCGCAGCCCACGAACCTCCCGAAGGCCCCCTACCAGCGCACCTATACCGAC
GGTCCCCTCTATGCGCCCGTCACGGGCTACCGGTCGATGGCTTACGGCCGCGCGGGCCTC
GAGGCCCTGTACGACGACTCGCTGAGCGCCGGGGCGCAGGGTGACGTCGCGACGACCATC
GAACCCGCCGTCCAGAAAGCCGCGTTCGACGCGCTGGGTGACCGGCAGGGCGCCGCGGTG
GCTCTCGACGCGGAGTCCGGGAGGCTTCTCACCCTGGTGAGTACGCCTTCCTACGACCCG
GGGCAGTTCAGCGGCCGCGGAGTGAAGGACGCCCAGGCGTGGAGGTCGGCCACCGCCGAC
AGCCGATCGCCGATGCTCAACCGGGCGCTGAAACAGGCCGATGCGCCGGGCGCGACCTTC
AGCGTCGTCGTCGCGGCCGCCGCCCTGGACGAAGGCCTCTACGCGACGGTGGACGACGCC
ACCGTCAGCCCGCTCACCTATGTGCTGCCCCTCTCGACGACGCGCGTGACCGGCGCGTCG
TCGCAGTGCGAGAACGCCTCCATCGGACTGGCGTTGCACCGCTCCTGCGCCAACGTGTTC
ACCAAGCTGGCCGCCGAGCTCGGTCAGGACCGACTCCGCGCCGCGGCACGGAAGTTCGGC
TTCGACGACGACACGCTCAAGGTGCCCTTGACGGTCGCCGAGAGCAGCTACCCCGGTGAC
GGCACGACGGCACCCGAAGCGGCCCTCACGGGGATGGGAGCCGGGGACGTCCGGGCAACT
CCGCTGCAGATGGCGCGAGTCGCGGCCGCGGTCGCCAACGGCGGGCGGCTGGTGTCCCCC
CGGCTGGTGGAAGGGGTGACGAAGGCCGACGGCACGACGCAGCTGCCCGAGGCCGCCGAC
GCTGGTTCTGCCGGGCAGGCGATGTCCCGGGGCACGGCTGAGGCGTTGCGGGCGGCACTC
GGTTCCGGCGGACAGGCGGGGTGGGTCCCCAGCGGTGACGGCGACCTGGCCGCCTCGTGG
TTCATCGGCTCCGCGCCGTCGGGCGACGGACGGCGCGTTGCCGTGGCGGTCCGGGTCGAG
GGCCTGCCGTCGACGGCCGGCGCCGAGGAGTCCGCCGGCGGACGGGCAGCGGCCGAGGCG
GCGGAGAAGATTCTCGCGAGCGTCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001460 Penicillin-binding protein, transpeptidase (Domain)
 [117-425]  3.09999999999998e-37 PF00905
PF00905   Transpeptidase
IPR012338 Beta-lactamase/transpeptidase-like (Domain)
 [100-428]  8.39998014024981e-50 SSF56601
SSF56601   PBP_transp_fold
 [99-427]  2.99999999999998e-53 G3DSA:3.40.710.10
G3DSA:3.40.710.10   G3DSA:3.40.710.10
SignalP
 [1-11]  0.254 Signal
Bacteria, Gram-negative   
TMHMM No significant hit