close all open/close all

CDS information : Indano_00050


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction4,402 / 5,160 / + [in whole cluster]
4,402 / 5,160 / + [in contig]
Location4402..5160 [in whole cluster]
4402..5160 [in contig]
TypeCDS
Length759 bp (252 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)type II thioesterase
Gene
Gene (GenBank)idmA
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)
Related Reference
ACC
Q6W5Q5
NITE
FR008_00110
PmId
[18836004] Selective removal of aberrant extender units by a type II thioesterase for efficient FR-008/candicidin biosynthesis in Streptomyces sp. strain FR-008. (Appl Environ Microbiol. , 2008)

close this sectionSequence

selected fasta
>putative type II thioesterase [type II thioesterase]
MAAPSTPTSAWVRRFHPEPEAATQVICFPHAGGSATFYFPVAQALSPAVDVLAIQYPGRQ
DRRVEPCIDDMDTLADLVSEELRPWLDRPFTLFGHSMGATLAFEVALRLERSGHTALGLF
ASGRRAPSRHRDEQVHLATDERLISEIKRLEGTESRVFEDEEIVRMILPAVRSDYRAAES
YRYRPGPALSCPVTALTGDRDPHVTLDEAEAWREHTTGPFRLRVFPGGHFFLNSHAQAVM
REITGLIDGSSE
selected fasta
>putative type II thioesterase [type II thioesterase]
ATGGCGGCACCGTCCACCCCGACCAGCGCCTGGGTCCGGCGCTTCCACCCGGAGCCGGAA
GCTGCGACGCAGGTGATCTGCTTTCCGCACGCAGGTGGTTCGGCCACGTTCTACTTCCCG
GTCGCCCAGGCCCTGTCGCCCGCCGTGGACGTACTCGCCATCCAGTATCCCGGCCGCCAG
GACCGGCGCGTCGAACCCTGCATCGACGACATGGACACCCTTGCCGACCTCGTCAGCGAG
GAACTGCGACCCTGGCTCGACCGGCCCTTCACCCTGTTCGGCCACAGCATGGGCGCCACG
CTGGCCTTCGAGGTCGCCCTCCGGCTGGAGCGCAGCGGACACACCGCGCTGGGGCTGTTC
GCGTCCGGTCGGCGCGCGCCCTCGCGGCACCGCGACGAACAGGTCCACCTCGCCACCGAC
GAACGCCTGATCAGCGAGATCAAACGGCTGGAGGGCACCGAGTCCCGGGTCTTCGAGGAC
GAGGAGATCGTCAGGATGATCCTGCCCGCCGTACGCAGCGACTACCGGGCCGCGGAGAGC
TACCGCTACCGGCCGGGACCCGCGTTGAGCTGCCCCGTCACCGCCCTCACCGGCGACCGC
GACCCGCACGTCACCCTCGACGAGGCCGAGGCATGGCGGGAGCACACCACGGGCCCCTTC
CGGCTCAGGGTCTTCCCCGGCGGGCACTTCTTCCTCAACTCCCATGCCCAGGCGGTGATG
CGGGAGATCACCGGCCTGATCGACGGCTCGTCCGAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [24-245]  9e-63 PF00975
PF00975   Thioesterase
SignalP
 [1-44]  0.259 Signal
Bacteria, Gram-negative   
TMHMM No significant hit