close all open/close all

CDS information : Indano_00060


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction5,170 / 6,759 / + [in whole cluster]
5,170 / 6,759 / + [in contig]
Location5170..6759 [in whole cluster]
5170..6759 [in contig]
TypeCDS
Length1,590 bp (529 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyl-CoA carboxylase beta subunit
Product (GenBank)acyl-CoA carboxylase
Gene
Gene (GenBank)idmB
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)
Related Reference
ACC
O86517
PmId
[11526020] Role of an essential acyl coenzyme A carboxylase in the primary and secondary metabolism of Streptomyces coelicolor A3(2). (Appl Environ Microbiol. , 2001)
[12048195] Kinetic and structural analysis of a new group of Acyl-CoA carboxylases found in Streptomyces coelicolor A3(2). (J Biol Chem. , 2002)
ACC
P53003
PmId
[8830278] Erythromycin production in Saccharopolyspora erythraea does not require a functional propionyl-CoA carboxylase. (Mol Microbiol. , 1996)
ACC
Q9X4K7
PmId
[10589718] Genetic and biochemical characterization of the alpha and beta components of a propionyl-CoA carboxylase complex of Streptomyces coelicolor A3(2). (Microbiology. , 1999)
[12048195] Kinetic and structural analysis of a new group of Acyl-CoA carboxylases found in Streptomyces coelicolor A3(2). (J Biol Chem. , 2002)

close this sectionSequence

selected fasta
>putative acyl-CoA carboxylase beta subunit [acyl-CoA carboxylase]
MPEESAGPGLGDARHARGRVAALHALRESVRSGPGERATAAQHAKGKLTARQRIELLLDE
GTFVELEPLRRHRATGFGLEVNKPYTDGVLTGWGTVHGRTVFVYAHDFRIFGGALGEAHA
EKIHKVMDRARAVGAPLVSLNDGAGARIQEGVTALAGYGGIFRRNTAASGVIPQISVMLG
PCAGGAAYSPALTDFVFMVRGTSQMFITGPDVVQAVTGEKVTHNGLGGADVHAETSGVCH
FAHDDEETCLDDVRYLLSLLPQNNRETPPYAAGDDRPDRRTDALVDLVPADGTRAYDMRE
VVRELVDDGEFLEVHERWAPNIVCALARLDGHVTGIVANQPQHLAGALDITASEKAARFV
QLCDAFSIPLLTLLDVPGFLPGTGQEHGGIIRHGAQLLYAYCNATVPRVSVVLRKAYGGA
YIVMDSQSIGADLTFAWPTNEIAVMGAEGAADVIFRKEIAQAEDPEAVRAGLIKEYRSEL
MHPYYAAERGLVDEVIDPADTRRVLIHSFAMLRHKHADLPLRKHGNPPM
selected fasta
>putative acyl-CoA carboxylase beta subunit [acyl-CoA carboxylase]
ATGCCCGAGGAGAGCGCGGGCCCCGGCCTGGGGGACGCACGGCACGCGCGCGGCCGGGTC
GCCGCCCTGCACGCACTGCGGGAGTCCGTCCGGAGCGGTCCGGGCGAACGGGCGACCGCC
GCGCAGCACGCCAAAGGAAAACTGACGGCCCGTCAGCGCATCGAACTGCTGCTGGACGAG
GGAACGTTCGTCGAGCTGGAACCCCTGCGCCGGCACCGGGCCACCGGCTTCGGGCTGGAG
GTGAACAAGCCGTACACCGACGGCGTGCTCACCGGCTGGGGCACGGTCCACGGCCGCACC
GTCTTCGTCTATGCCCACGACTTCCGCATCTTCGGCGGTGCGCTCGGCGAGGCGCACGCC
GAGAAGATCCACAAGGTGATGGACCGGGCCAGAGCGGTCGGAGCCCCGCTGGTCAGCCTC
AACGACGGCGCCGGAGCCAGGATCCAGGAAGGCGTCACCGCGCTCGCCGGATACGGCGGC
ATCTTCCGACGCAACACCGCGGCCTCCGGCGTCATCCCGCAGATCAGCGTGATGCTCGGG
CCCTGCGCGGGCGGCGCCGCCTACTCCCCGGCGCTGACGGACTTCGTCTTCATGGTCCGC
GGGACCTCGCAGATGTTCATCACCGGACCCGACGTGGTCCAGGCCGTCACCGGCGAGAAG
GTCACGCACAACGGGCTGGGCGGCGCGGACGTGCACGCCGAGACCTCGGGCGTGTGCCAC
TTCGCCCACGACGACGAGGAGACCTGCCTCGACGACGTCCGCTACCTGCTCTCGCTGCTC
CCGCAGAACAACCGGGAGACCCCGCCGTACGCGGCGGGCGACGATCGGCCCGACCGCCGC
ACCGACGCGCTGGTGGACCTGGTGCCGGCCGACGGCACGCGCGCGTACGACATGCGGGAG
GTCGTCCGGGAACTCGTCGACGACGGGGAATTCCTGGAGGTCCACGAGCGCTGGGCACCG
AACATCGTCTGCGCCCTCGCCCGGCTGGACGGCCATGTGACGGGCATCGTCGCCAACCAG
CCGCAGCACCTGGCCGGCGCCCTGGACATCACCGCGTCCGAGAAGGCCGCACGCTTCGTT
CAGCTCTGCGACGCCTTCAGCATCCCCCTGCTGACGCTGCTGGACGTGCCCGGCTTCCTG
CCGGGCACGGGCCAGGAGCACGGCGGCATCATCCGGCACGGCGCCCAACTGCTGTACGCC
TACTGCAACGCCACCGTCCCCCGCGTCTCCGTGGTGCTGCGCAAGGCCTACGGGGGCGCG
TACATCGTCATGGACTCCCAGTCCATCGGCGCCGACCTGACCTTCGCCTGGCCCACCAAC
GAGATCGCCGTGATGGGCGCCGAAGGCGCGGCCGACGTGATCTTCCGCAAGGAGATCGCG
CAGGCGGAGGACCCGGAGGCCGTGCGCGCCGGTCTGATCAAGGAGTACCGGTCGGAACTG
ATGCACCCCTACTACGCCGCCGAGCGTGGGCTGGTGGACGAGGTGATCGACCCTGCCGAC
ACCCGCCGGGTCCTGATCCACTCGTTCGCCATGCTCCGGCACAAGCACGCCGACCTTCCG
CTGCGCAAGCACGGCAACCCGCCGATGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000022 Carboxyl transferase (Domain)
 [41-526]  PF01039
PF01039   Carboxyl_trans
IPR011762 Acetyl-coenzyme A carboxyltransferase, N-terminal (Domain)
 [22-236]  PS50980
PS50980   COA_CT_NTER
IPR011763 Acetyl-coenzyme A carboxyltransferase, C-terminal (Domain)
 [237-521]  PS50989
PS50989   COA_CT_CTER
SignalP No significant hit
TMHMM No significant hit