close all open/close all

CDS information : Indano_00070


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction8,444 / 6,894 / - [in whole cluster]
8,444 / 6,894 / - [in contig]
Locationcomplement(6894..8444) [in whole cluster]
complement(6894..8444) [in contig]
TypeCDS
Length1,551 bp (516 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)efflux transporter
Gene
Gene (GenBank)idmC
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)
Related Reference
ACC
O52557
NITE
Rifam_00370
PmId
[17351715] RifP; a membrane protein involved in rifamycin export in Amycolatopsis mediterranei. (Biotechnol Lett. , 2007)

close this sectionSequence

selected fasta
>putative drug resistance transporter [efflux transporter]
MTNEDSRRWWALAAIGLSLLTVSVDATILNVALPTVSTELGASTSDLQWFVDAFTLAMAA
LLLPAGLLGDRLGRKTMLMASLFLFGLASLWCAYSGSAGMLIAARTVLGISAAFLVPLCT
SVLLDIFEGEHERAKAIGVIAVTQSLGLPLGPIIGGALLNHFWWGSVFLINVPLVAVGLL
AVARLVPSSRGSQHGAIDLLGVLLSSVGLVALVYGAIEAGERGWSDPQSLLPLIGGLALL
VVFVLWEVRVAVSRDPLLDLSLFRSAGFVWGSILGTVVSFAMFGLIFALPQYFQAVDGTD
ALGTGLRLLPLIGGVLVSAAVIRSSPEAAPRAVPTAGFVLVAIGLFMGTRTSLSTDYGFV
ALWLVITGLGLGLAMTRTMAAAVNSLSKERSGVGSAVVSALRQVGGAVGVAVLGTIANAS
YRSHLTLPGLPDDAKEAARRSVGAGVAVGEQLGSPAVVRSVQDAFVHAMQSLLAVCGGIA
VVAAVLALLFMPKRAAGTEPHGEGDEQGSSALRKAA
selected fasta
>putative drug resistance transporter [efflux transporter]
GTGACTAACGAGGACTCCCGCCGCTGGTGGGCCCTGGCGGCGATCGGCTTAAGTCTCCTG
ACCGTCAGTGTGGATGCCACGATCCTCAACGTCGCACTGCCGACGGTCAGTACGGAACTC
GGCGCGTCGACCAGTGACCTGCAGTGGTTCGTCGACGCGTTCACCCTGGCCATGGCCGCC
CTGCTGCTTCCGGCAGGTCTGCTCGGAGACCGGCTGGGCCGCAAGACCATGCTGATGGCC
TCGCTGTTCCTCTTCGGCCTTGCCTCGCTGTGGTGCGCCTACTCCGGGTCCGCGGGCATG
CTCATCGCGGCCCGGACGGTGCTCGGCATCAGCGCGGCGTTCCTCGTGCCGCTGTGCACC
TCCGTGCTCCTCGACATCTTCGAGGGCGAGCACGAACGGGCGAAGGCCATCGGTGTCATC
GCCGTAACCCAGTCACTGGGCCTCCCGCTCGGTCCGATCATCGGCGGCGCCCTGCTCAAC
CACTTCTGGTGGGGTTCGGTCTTCCTCATCAACGTGCCGCTCGTCGCCGTGGGCCTGCTC
GCCGTGGCCCGCCTGGTGCCGTCCTCACGGGGTTCACAGCACGGTGCCATCGACCTCCTC
GGCGTACTGCTCTCCAGTGTCGGCCTGGTCGCCCTCGTCTACGGTGCGATCGAGGCCGGC
GAGAGGGGCTGGAGCGACCCTCAGTCCCTGCTGCCGCTGATCGGTGGCCTGGCACTGCTG
GTCGTCTTCGTCCTGTGGGAGGTCCGGGTCGCGGTCTCCCGGGATCCCCTGCTGGACCTG
TCCCTGTTCCGCAGCGCCGGATTCGTGTGGGGCTCGATCCTCGGCACCGTCGTCAGCTTC
GCGATGTTCGGGCTCATCTTCGCCCTGCCCCAGTACTTCCAGGCGGTCGACGGGACGGAC
GCGCTGGGCACGGGCCTGCGGCTGCTGCCGCTGATCGGTGGGGTACTGGTCAGCGCCGCC
GTCATCCGCAGCTCCCCCGAGGCCGCCCCCCGCGCGGTGCCCACGGCCGGTTTCGTCCTC
GTCGCGATCGGCCTGTTCATGGGCACCAGGACCTCGCTCTCCACCGACTACGGGTTCGTG
GCCCTCTGGCTCGTGATCACGGGGCTGGGTCTCGGTCTCGCCATGACCCGGACGATGGCG
GCGGCGGTCAACTCCCTGTCCAAGGAACGCTCCGGCGTCGGCTCCGCGGTCGTCTCGGCA
CTGCGTCAGGTGGGCGGCGCGGTGGGTGTGGCGGTGCTCGGCACGATCGCCAACGCGAGC
TACCGGTCGCATCTGACGCTCCCCGGCCTGCCCGATGACGCGAAGGAGGCCGCCCGGCGC
AGCGTCGGAGCCGGGGTGGCGGTGGGCGAGCAGTTGGGAAGCCCCGCCGTCGTGCGCTCC
GTGCAGGACGCCTTCGTCCACGCGATGCAGTCCCTTCTCGCGGTGTGCGGCGGTATCGCC
GTGGTCGCCGCGGTGCTGGCCCTGCTGTTCATGCCGAAGCGGGCGGCCGGTACAGAGCCG
CACGGCGAGGGCGACGAGCAGGGGTCCTCGGCGCTCCGGAAAGCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004638 Drug resistance transporter EmrB/QacA subfamily (Family)
 [17-487]  1.69999999999998e-79 TIGR00711
TIGR00711   Efflux_EmrB
IPR011701 Major facilitator superfamily (Family)
 [17-409]  1.6e-45 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-507]  7.19996395544006e-69 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [11-495]  PS50850
PS50850   MFS
SignalP
 [1-26]  0.953 Signal
Bacteria, Gram-negative   
 [1-26]  0.926 Signal
Eukaryota   
 [1-42]  0.847 Signal
Bacteria, Gram-positive   
TMHMM
 [12-34]  Transmembrane (i-o) [49-68]  Transmembrane (o-i) [81-103]  Transmembrane (i-o) [107-124]  Transmembrane (o-i) [137-159]  Transmembrane (i-o) [164-186]  Transmembrane (o-i) [199-216]  Transmembrane (i-o) [231-253]  Transmembrane (o-i) [266-288]  Transmembrane (i-o) [303-325]  Transmembrane (o-i) [332-349]  Transmembrane (i-o) [359-381]  Transmembrane (o-i) [394-416]  Transmembrane (i-o) [468-490]  Transmembrane (o-i)
Transmembrane 14