close all open/close all

CDS information : Indano_00080


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction9,033 / 8,437 / - [in whole cluster]
9,033 / 8,437 / - [in contig]
Locationcomplement(8437..9033) [in whole cluster]
complement(8437..9033) [in contig]
TypeCDS
Length597 bp (198 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)MarR regulatory protein
Gene
Gene (GenBank)idmD
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [MarR regulatory protein]
MSSDGGDQADQADQDTDAARVRKWVEQVGTWFMQQSGWPPIMGRTLAWLMVSDPPEQNPA
QIAAAVQASRASLTSTLRLLTEARMIQAVTRSGDRSTYYRVAPDAWSAMLRRRLESIASF
SDITDEGLGLFPQGAHRAERLREAHRVFEWLNVEAEPLLKRWDDVRDTFTPDDTATGAGP
APATPPADHPPRKEGHRD
selected fasta
>hypothetical protein [MarR regulatory protein]
ATGTCGTCCGACGGCGGCGACCAGGCCGATCAGGCCGATCAGGACACCGACGCCGCGCGG
GTCCGGAAATGGGTCGAGCAGGTCGGCACCTGGTTCATGCAGCAGTCCGGCTGGCCTCCG
ATCATGGGACGGACGCTGGCCTGGCTGATGGTCAGCGACCCGCCGGAGCAGAATCCCGCC
CAGATCGCCGCCGCCGTACAGGCGAGCCGGGCCTCGCTCACCAGCACACTGCGGCTGCTG
ACCGAGGCCCGGATGATCCAGGCCGTCACCCGCAGCGGGGACCGTTCCACGTACTACCGC
GTCGCGCCGGACGCCTGGTCCGCCATGCTCCGCCGACGGCTGGAGAGCATCGCCTCCTTC
TCCGACATCACGGACGAGGGGCTGGGCCTGTTCCCGCAGGGCGCGCACCGGGCGGAACGC
CTGCGCGAAGCGCACCGGGTCTTCGAGTGGCTCAACGTCGAGGCGGAACCGCTGCTCAAG
CGCTGGGACGACGTACGCGACACCTTCACCCCCGATGACACGGCGACCGGCGCCGGTCCT
GCGCCGGCGACGCCGCCCGCAGACCACCCCCCACGGAAAGAAGGACACCGTGACTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [32-99]  2.8e-08 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit