close all open/close all

CDS information : Indano_00090


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction10,840 / 9,131 / - [in whole cluster]
10,840 / 9,131 / - [in contig]
Locationcomplement(9131..10840) [in whole cluster]
complement(9131..10840) [in contig]
TypeCDS
Length1,710 bp (569 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 3-hydroxyacyl-CoA dehydrogenase
putative beta-keto-reductase
Product (GenBank)hydroxybutyryl-CoA dehydrogenase
Gene
Gene (GenBank)idmE
EC number1.1.1.35
Keyword
  • ethylmalonyl-CoA
Note
Note (GenBank)
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)
Related Reference
ACC
P52041
PmId
[8655474] Cloning, sequencing, and expression of clustered genes encoding beta-hydroxybutyryl-coenzyme A (CoA) dehydrogenase, crotonase, and butyryl-CoA dehydrogenase from Clostridium acetobutylicum ATCC 824. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>putative 3-hydroxyacyl-CoA dehydrogenase [hydroxybutyryl-CoA dehydrogenase]
MTQQTPVIGVIGLGTIGSALLTLLRDASREVIGVDHDPSVLARLSGRLEAADAESVTLTG
DLGRLSRADLVVEAVGEDEAVKTEVLRRLRTVCREETVVVSTTASVPLIRLAALSGRPGN
TMGLRFLTPPRPGGPVEAVRTTLTSQHTATVVDRLVGELGLTPVKVDTRCAADATALVHA
YLNRAAALYERGGASRDGIDTAMRLGCGLPFGPLELLDRIGIDSALATLTDLHRRTGDAS
FLPAGMLGELVGQGHLGRKSGRGFYAYDDSGRPVDAEESVAVPGTAAGVDRVAVVGSGTM
ARGIAEITSVAGIPTVLVARSQEKAARSLAKIGESLSRGVLRGRVTPATRAAALDLLDGS
DDIRAVSDCDLVIEAVVEDLDVKRALFARLGAACKPGALLATTTSSLSVTACSEPAGHAS
GVVGMHFFNPAPVMRLVELVRTDDTTDEALATAQAVCERLGKTTVHCRDRVGFIVNYLLF
PYLGRALTLLDRDGASVEGIDTAVEQGFGHPMGPFALLDAIGLDVSLAIQRELHAEFGEP
DFAPSPLLELLVSGGWLGRKNRRGLRTAG
selected fasta
>putative 3-hydroxyacyl-CoA dehydrogenase [hydroxybutyryl-CoA dehydrogenase]
ATGACGCAGCAGACGCCCGTGATCGGGGTCATCGGTCTGGGGACGATCGGATCCGCGCTG
CTCACGCTGTTGCGGGACGCGTCTCGCGAGGTGATCGGCGTGGACCACGACCCGTCCGTC
CTGGCGCGGTTGAGCGGTCGGCTCGAAGCCGCCGACGCCGAAAGCGTGACCCTCACCGGG
GATCTCGGCCGGTTGAGCCGCGCCGACCTGGTCGTCGAGGCGGTCGGCGAGGACGAGGCG
GTCAAGACCGAGGTCCTGCGCCGCCTCCGTACCGTCTGCCGCGAGGAGACGGTGGTGGTC
AGCACTACGGCCTCCGTGCCGCTGATCCGGCTCGCCGCCCTCTCCGGGCGCCCCGGGAAC
ACCATGGGCCTGCGTTTCCTCACCCCGCCCCGCCCCGGCGGACCGGTGGAGGCGGTCCGC
ACGACGTTGACCTCACAGCACACCGCGACCGTCGTGGACAGGCTGGTGGGCGAGCTCGGT
CTGACGCCGGTCAAGGTGGACACCCGCTGCGCCGCCGACGCCACCGCCCTGGTCCACGCC
TACCTCAACCGAGCGGCCGCCCTGTACGAGCGGGGCGGCGCGAGCAGGGACGGCATCGAC
ACCGCCATGCGCCTGGGCTGCGGCCTCCCCTTCGGACCGCTGGAACTGCTGGACCGCATC
GGCATCGACTCGGCCCTGGCCACGCTCACCGACCTGCACCGGCGCACCGGCGACGCGTCC
TTCCTGCCCGCCGGAATGCTGGGCGAGCTGGTCGGGCAGGGGCACCTGGGACGCAAGAGC
GGCCGCGGCTTCTACGCGTACGACGACTCCGGACGGCCCGTGGACGCGGAGGAGTCCGTC
GCCGTACCGGGCACGGCGGCCGGTGTGGACCGGGTCGCCGTCGTGGGGTCGGGGACGATG
GCCCGGGGCATCGCGGAGATCACCTCGGTCGCGGGCATCCCGACGGTCCTGGTGGCGCGG
AGCCAGGAGAAGGCGGCCCGGTCCCTGGCGAAGATCGGCGAGTCGTTGTCCCGCGGTGTC
CTGCGGGGCCGGGTCACTCCCGCGACGAGGGCCGCGGCGCTGGATCTGCTCGACGGCAGC
GACGACATCCGCGCGGTGAGCGACTGCGACCTGGTGATCGAGGCTGTGGTGGAGGACCTC
GACGTCAAGCGGGCGCTCTTCGCCCGGCTCGGCGCGGCGTGCAAGCCCGGCGCGCTGCTC
GCGACCACGACCTCCAGCCTGTCGGTCACCGCGTGCTCCGAGCCGGCCGGGCATGCCTCG
GGGGTGGTCGGGATGCACTTCTTCAACCCGGCGCCGGTGATGCGGCTGGTCGAACTCGTA
CGCACCGACGACACCACCGACGAGGCGCTGGCCACCGCGCAGGCGGTCTGCGAGCGGCTG
GGCAAGACGACGGTGCACTGCCGGGACCGGGTCGGATTCATCGTGAACTACCTCCTGTTC
CCCTACCTGGGGCGGGCGCTGACACTGCTGGACCGGGACGGGGCCAGCGTCGAGGGCATC
GACACCGCCGTCGAGCAGGGCTTCGGTCACCCGATGGGTCCGTTCGCCCTGCTCGACGCC
ATCGGACTGGACGTCTCACTCGCCATCCAGCGTGAGCTGCACGCCGAGTTCGGCGAGCCG
GACTTCGCGCCGTCGCCGCTCCTGGAACTGCTCGTGAGCGGCGGCTGGCTCGGCCGCAAG
AACCGCAGGGGGCTGCGGACGGCGGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006108 3-hydroxyacyl-CoA dehydrogenase, C-terminal (Domain)
 [177-267]  9.50000000000001e-21 PF00725 [472-565]  1.5e-25 PF00725
PF00725   3HCDH
IPR006176 3-hydroxyacyl-CoA dehydrogenase, NAD binding (Domain)
 [8-167]  5.69999999999998e-25 PF02737 [291-469]  3.2e-57 PF02737
PF02737   3HCDH_N
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [171-268]  2.30000440726534e-22 SSF48179 [472-569]  3.0999994589937e-25 SSF48179
SSF48179   6DGDH_C_like
IPR013328 Dehydrogenase, multihelical (Domain)
 [176-267]  6.90000000000001e-54 G3DSA:1.10.1040.10 [474-564]  6.90000000000001e-54 G3DSA:1.10.1040.10
G3DSA:1.10.1040.10   Opine_DH
IPR016040 NAD(P)-binding domain (Domain)
 [8-166]  2.39999999999997e-71 G3DSA:3.40.50.720 [287-473]  2.39999999999997e-71 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [7-24]  Transmembrane (i-o)
Transmembrane 1