close all open/close all

CDS information : Indano_00100


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction12,213 / 10,837 / - [in whole cluster]
12,213 / 10,837 / - [in contig]
Locationcomplement(10837..12213) [in whole cluster]
complement(10837..12213) [in contig]
TypeCDS
Length1,377 bp (458 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative crotonyl-CoA reductase
Product (GenBank)crotonyl-CoA reductase/carboxylase
Gene
Gene (GenBank)idmF
EC number1.3.1.-
Keyword
  • ethylmalonyl-CoA
Note
Note (GenBank)
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)
Related Reference
ACC
Q9RNU6
PmId
[10542184] Role of crotonyl coenzyme A reductase in determining the ratio of polyketides monensin A and monensin B produced by Streptomyces cinnamonensis. (J Bacteriol. , 1999)
ACC
Q53865
PmId
[8521864] Purification of crotonyl-CoA reductase from Streptomyces collinus and cloning, sequencing and expression of the corresponding gene in Escherichia coli. (Eur J Biochem. , 1995)
ACC
B8XVS5
PmId
[17548827] Synthesis of C5-dicarboxylic acids from C2-units involving crotonyl-CoA carboxylase/reductase: the ethylmalonyl-CoA pathway. (Proc Natl Acad Sci U S A. , 2007)
[19458256] Carboxylation mechanism and stereochemistry of crotonyl-CoA carboxylase/reductase, a carboxylating enoyl-thioester reductase. (Proc Natl Acad Sci U S A. , 2009)

close this sectionSequence

selected fasta
>putative crotonyl-CoA reductase [crotonyl-CoA reductase/carboxylase]
MEEIISAILADGTTSEDISGLRIPDTYRAVTIRKDDIGLFEGMASADKDPRKSLHLDEVP
VPELGPGEALVAVMASSVNYNSVWTSIFEPLPTFHFLKRYGATSAMAARHDLPYHVIGSD
LAGVVLRTGPGVNAWKPGDEVVAHCLSVELESSDGHNDTMLDPEQRIWGFETNFGGLAEI
ALVKSNQLMPKPDHLSWEEAAAPGLVNSTAYRQLVSRNGAGMKQGDNVLIWGASGGLGSY
ATQFALAGGANPICVVSSPEKADICRAMGAEAVIDRNAEGYRFWKDERTQDPKEWKRFGK
RIREFTGGEDIDIVFEHPGRETFGASVYVTRKGGTITTCASTSGYMHEYDNRYLWMSLKR
IIGSHFANYREAWEANRLIAKGKIHPTLSKVYSLEDTGQAAYDVHRNLHQGKVGVLALAP
QEGLGVRDEDKRAQHIDAINRFRATAAAPRPRRGAPQS
selected fasta
>putative crotonyl-CoA reductase [crotonyl-CoA reductase/carboxylase]
GTGGAAGAAATCATCAGCGCCATTCTTGCCGACGGCACGACGAGCGAGGACATCTCCGGC
CTGCGAATACCGGACACCTATCGCGCCGTCACCATCCGGAAGGACGACATCGGTCTCTTC
GAAGGGATGGCGTCGGCCGACAAGGACCCCCGTAAGTCGCTGCATCTCGACGAGGTACCG
GTGCCCGAACTGGGCCCGGGTGAGGCTCTGGTGGCCGTCATGGCCTCCTCGGTCAACTAC
AACTCCGTGTGGACCTCGATCTTCGAGCCGCTGCCCACCTTTCACTTCCTGAAGCGATAC
GGCGCGACGTCCGCCATGGCCGCCCGCCACGATCTGCCGTACCACGTCATCGGTTCCGAC
CTGGCGGGCGTGGTCCTGCGCACCGGTCCGGGCGTCAACGCCTGGAAGCCGGGCGACGAG
GTCGTGGCGCACTGTCTGTCCGTGGAGCTGGAGTCCTCGGACGGCCACAACGACACGATG
CTCGACCCCGAGCAGCGGATCTGGGGCTTCGAGACCAACTTCGGCGGCCTCGCCGAGATC
GCCCTGGTCAAGTCCAACCAGCTGATGCCCAAGCCCGACCACCTGTCGTGGGAGGAGGCG
GCGGCCCCCGGCCTGGTCAACTCCACCGCCTACCGCCAGCTCGTCTCCCGCAACGGCGCC
GGCATGAAGCAGGGCGACAACGTCCTGATCTGGGGCGCCAGCGGCGGACTCGGCTCCTAC
GCCACGCAGTTCGCGCTGGCCGGCGGCGCCAACCCGATCTGTGTCGTCTCCTCCCCCGAG
AAGGCCGACATCTGCCGGGCCATGGGCGCCGAGGCGGTCATCGACCGCAACGCCGAGGGC
TACCGGTTCTGGAAGGACGAGCGCACCCAGGACCCCAAGGAGTGGAAGCGCTTCGGCAAG
CGCATCCGCGAGTTCACCGGCGGCGAGGACATCGACATCGTCTTCGAGCACCCCGGCCGC
GAGACCTTCGGCGCCTCGGTCTACGTCACCCGCAAGGGCGGCACCATCACCACCTGCGCC
TCGACCTCCGGCTACATGCACGAGTACGACAACCGCTACCTGTGGATGTCCCTGAAGCGG
ATCATCGGCTCGCACTTCGCCAACTACCGCGAGGCCTGGGAGGCCAACCGGCTGATCGCG
AAGGGCAAGATCCACCCGACGCTGTCGAAGGTGTACTCCCTCGAGGACACCGGGCAGGCC
GCCTACGACGTGCACCGCAACCTCCACCAGGGCAAGGTCGGCGTCCTCGCGCTGGCCCCC
CAGGAGGGGCTGGGCGTGCGCGACGAGGACAAGCGCGCCCAGCACATCGACGCCATCAAC
CGCTTCCGCGCAACGGCGGCCGCCCCTCGGCCGCGAAGGGGGGCACCGCAGTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010085 Crotonyl-CoA reductase (Family)
 [32-428]  TIGR01751
TIGR01751   Crot-CoA-red
IPR011032 GroES-like (Domain)
 [40-233]  3.60000433965927e-31 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [236-380]  8.70000000000003e-40 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [112-190]  1.4e-06 PF08240
PF08240   ADH_N
IPR016040 NAD(P)-binding domain (Domain)
 [231-364]  1.9e-22 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-15]  0.054 Signal
Eukaryota   
TMHMM No significant hit