close all open/close all

CDS information : Indano_00110


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction13,164 / 15,890 / + [in whole cluster]
13,164 / 15,890 / + [in contig]
Location13164..15890 [in whole cluster]
13164..15890 [in contig]
TypeCDS
Length2,727 bp (908 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)LuxR family transcriptional regulator
Gene
Gene (GenBank)idmG
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)
Related Reference
ACC
Q9S0N8
NITE
Aver_00010
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[19148632] Characterization of a regulatory gene, aveR, for the biosynthesis of avermectin in Streptomyces avermitilis. (Appl Microbiol Biotechnol. , 2009)
[20012992] The pathway-specific regulator AveR from Streptomyces avermitilis positively regulates avermectin production while it negatively affects oligomycin biosynthesis. (Mol Genet Genomics. , 2010)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [LuxR family transcriptional regulator]
MILVNREAELGLLKSGLAECAAGRAKMIVVEGGVGCGKSELLDTFTEYATEQGAAVLRGM
GIRSASDQPLALLRQLLGQVPGWVPSEPGVGEQEFGEALHRLASRSPVVVCVDDAQYGDS
RSLHHLLQAAGFTRSARILLVFGDSLHLPRRDPVIKTELLRQSNSLRIRLGPLTKQGTAA
LLAAQGGDAQDRPLVDRLHFITAGNPLLLRALLEECRPATADSGIADKIEPMEGGLYGQA
VLASLYRSGPAALELGHALAVLDEPRAHAILPRLVDQPSALIDQNLQALTAAGMIAGTAF
RHQAAVATVLADLAPDRRTALHSWVAVALHSAGYPASVVARHLLKARSAAQPWELIALRN
AAEEALAEDDAVLAIDCLELAHEACPDPVQRIEIKMRLALITWRTNPAAAEYRHLPELLS
AMRRGELSPTSLGMLGKLLSAHGRIVEAMEVLRLSEDASCDVPRPVPGIHPTIASMWVRY
GFHGVDFPDSGQRGGAAQGPASDSGSLVNGSVPGIPLLRKSAEDVLIAAQDWSGSAESFL
EMCSLTDSMVAPVCSALKALLYSDQVEAAAQWCAKILDEATRRNIPGWQGVLAVVQGMIA
LRQGKLEEAVASASMALEVVPERNGSVLVCGTSSILAMAYTEMGRYDAAVRLLDQPVSQD
WFDSVYWLGYLRARGHFHLATNRSHAALSDFLRIGNLAGSWGIDHPMLVSWRTDAAQAWL
QLGEPSQAQQLLDAEVSQEFPGYGRLRGITLRLQAAIAPLTDRVQLLGRAVEEFDAGNDR
LELAKALADLSEAHEALGNQTRADLVRRKGRHLAAECGADPLYRRMAAGGRNRMVAADSE
SGSVRTEPKPGVDLTEAEYRVASLASYGHTNREISQQLYITVSTVEQHLTRIYQKLRITR
RQEIPVDL
selected fasta
>putative LuxR family transcriptional regulator [LuxR family transcriptional regulator]
ATGATACTGGTCAATCGTGAAGCGGAACTTGGGCTACTGAAGTCCGGACTCGCGGAATGC
GCAGCCGGGCGGGCCAAGATGATCGTCGTGGAAGGCGGCGTGGGCTGCGGCAAGAGCGAG
TTGCTGGACACGTTCACGGAATATGCCACCGAACAGGGGGCGGCGGTCCTCAGAGGGATG
GGCATACGCTCCGCATCCGATCAGCCCCTCGCCCTGCTACGCCAGTTACTGGGGCAGGTG
CCGGGCTGGGTTCCCTCCGAACCCGGCGTCGGGGAGCAGGAGTTCGGCGAGGCCCTCCAC
CGGCTGGCGAGCCGGAGCCCCGTGGTCGTCTGTGTGGACGACGCGCAGTACGGCGACAGC
CGGTCGCTTCACCACTTGTTGCAAGCGGCGGGCTTCACCCGATCCGCCCGGATCCTCCTC
GTGTTCGGCGACAGCCTGCACCTCCCGCGCCGGGACCCGGTGATCAAGACGGAGCTGCTG
CGGCAGTCCAACTCACTGCGGATCCGGCTGGGTCCGCTGACCAAGCAGGGCACCGCCGCG
CTGCTCGCCGCGCAGGGCGGCGACGCACAGGACCGTCCCCTCGTGGACCGGCTGCACTTC
ATCACCGCCGGAAACCCGCTGCTCCTGCGGGCGCTGCTGGAGGAATGCCGTCCCGCCACC
GCAGACTCCGGGATCGCGGACAAGATCGAGCCCATGGAGGGCGGACTCTACGGACAGGCG
GTCCTCGCCAGCCTGTACCGCAGTGGTCCGGCCGCCCTGGAGCTGGGGCACGCGCTCGCC
GTCCTGGACGAGCCGAGGGCCCACGCGATCCTGCCCAGGCTGGTCGACCAGCCCTCGGCG
CTGATCGACCAGAACCTCCAGGCCCTCACCGCGGCCGGCATGATCGCGGGCACCGCGTTC
CGGCACCAGGCCGCCGTCGCGACCGTCCTGGCCGACCTGGCGCCCGACCGCCGTACCGCC
CTGCACTCCTGGGTGGCCGTGGCCCTGCACTCCGCCGGATATCCGGCGTCGGTGGTCGCG
CGCCACCTGCTCAAAGCGCGCAGCGCCGCCCAGCCCTGGGAGCTCATCGCGCTGCGCAAC
GCCGCCGAGGAGGCACTCGCCGAGGACGATGCCGTCCTGGCCATCGACTGTCTCGAACTG
GCTCATGAGGCCTGCCCTGACCCGGTCCAACGGATCGAGATCAAGATGCGGCTGGCGCTG
ATCACCTGGCGCACCAACCCCGCGGCCGCGGAGTACCGCCATCTCCCTGAACTCCTCAGC
GCCATGCGGCGGGGCGAGCTGTCGCCGACCAGTCTCGGCATGCTCGGCAAGCTGCTGTCC
GCGCACGGCCGCATAGTGGAGGCGATGGAGGTCCTCCGGCTGAGCGAGGACGCGTCGTGC
GACGTGCCCCGGCCCGTCCCCGGCATCCACCCCACCATCGCCTCGATGTGGGTGCGCTAC
GGGTTCCACGGCGTGGACTTCCCCGACAGCGGCCAGCGCGGCGGCGCGGCGCAGGGGCCG
GCCTCCGACTCCGGCTCCCTGGTCAACGGTTCCGTCCCCGGCATACCGCTGCTGCGGAAG
TCCGCGGAGGACGTGCTCATCGCCGCGCAGGACTGGAGCGGGTCCGCGGAGAGTTTCCTG
GAGATGTGCTCCCTCACCGACTCGATGGTGGCCCCGGTGTGCAGCGCGCTCAAGGCGCTG
CTCTACTCCGACCAGGTCGAGGCGGCGGCGCAGTGGTGCGCGAAGATCCTGGATGAGGCC
ACCCGCCGCAACATCCCGGGCTGGCAGGGGGTGTTGGCCGTCGTCCAGGGGATGATCGCG
CTGCGGCAGGGCAAGTTGGAGGAGGCCGTCGCCAGCGCGTCCATGGCGCTGGAAGTGGTC
CCCGAGCGCAACGGCAGCGTGCTGGTCTGTGGTACCTCCTCCATCCTGGCCATGGCATAC
ACCGAGATGGGGCGCTACGACGCCGCGGTACGCCTGCTCGACCAGCCGGTCTCCCAGGAC
TGGTTCGACAGCGTGTACTGGCTCGGCTACCTGCGGGCGCGGGGGCACTTCCATCTGGCG
ACGAACCGCTCGCATGCCGCTCTGTCGGACTTCCTGAGAATCGGGAACCTGGCGGGCAGC
TGGGGGATCGACCACCCCATGCTGGTGTCGTGGCGCACCGACGCGGCCCAGGCGTGGCTC
CAGCTCGGGGAGCCGTCCCAGGCCCAGCAGCTGCTCGACGCCGAAGTCAGCCAGGAGTTC
CCCGGGTACGGCCGGCTTCGGGGGATCACCCTGAGGCTGCAGGCCGCGATCGCGCCGCTG
ACCGACCGCGTACAGCTGCTCGGTCGGGCCGTCGAGGAGTTCGACGCAGGCAATGACCGG
CTGGAACTGGCCAAGGCGCTGGCCGACCTCAGTGAGGCGCATGAGGCGCTGGGCAACCAG
ACCCGCGCGGATCTGGTCAGGCGCAAGGGCCGGCATCTCGCCGCGGAATGCGGGGCGGAT
CCGCTGTACCGGCGCATGGCCGCCGGCGGACGGAACAGGATGGTCGCCGCGGATTCGGAA
TCCGGCTCGGTGCGAACCGAACCGAAACCCGGAGTGGATCTGACCGAAGCGGAGTACCGG
GTGGCCTCGCTGGCGTCCTACGGTCATACCAATCGCGAGATATCCCAGCAACTGTATATA
ACCGTCAGTACCGTCGAGCAGCATCTCACGCGGATATACCAGAAACTCCGGATAACGCGA
CGCCAGGAGATACCGGTCGATCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [851-908]  4.90001027782405e-18 SM00421
SM00421   HTH_LUXR
 [847-908]  PS50043
PS50043   HTH_LUXR_2
 [868-895]  PS00622
PS00622   HTH_LUXR_1
 [853-904]  1.2e-08 PF00196
PF00196   GerE
 [854-868]  5.20000089003336e-08 PR00038 [868-884]  5.20000089003336e-08 PR00038 [884-896]  5.20000089003336e-08 PR00038
PR00038   HTHLUXR
IPR011990 Tetratricopeptide-like helical (Domain)
 [561-861]  9.20000000000002e-20 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [862-904]  8.5e-16 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [832-904]  6.20000124972815e-12 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit