close all open/close all

CDS information : Indano_00120


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction16,454 / 16,017 / - [in whole cluster]
16,454 / 16,017 / - [in contig]
Locationcomplement(16017..16454) [in whole cluster]
complement(16017..16454) [in contig]
TypeCDS
Length438 bp (145 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative hydroxylase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)idmH
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)
[21491871] Identification of a tetraene-containing product of the indanomycin biosynthetic pathway. (Org Lett. , 2011)
Related Reference
ACC
Q1XDX7
PmId
[16650858] Crystal structures of SnoaL2 and AclR: two putative hydroxylases in the biosynthesis of aromatic polyketide antibiotics. (J Mol Biol. , 2006)
ACC
Q9RN64
NITE
Nogl_00150
PmId
[16650858] Crystal structures of SnoaL2 and AclR: two putative hydroxylases in the biosynthesis of aromatic polyketide antibiotics. (J Mol Biol. , 2006)
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[22633406] SnoaW/SnoaL2: a different two-component monooxygenase. (Chem Biol. , 2012)
[22633415] Discovery of a two-component monooxygenase SnoaW/SnoaL2 involved in nogalamycin biosynthesis. (Chem Biol. , 2012)

close this sectionSequence

selected fasta
>putative hydroxylase [hypothetical protein]
MAHQPSDTIAGLYEAFNSGDLETLRELIAPDAVIHLPGTAGDAEHPPGTPRDREGWLGVW
QFTQAFFPDMTATVQDIVQTGDLVATRCVARGTHSIEFMGVPPTGRPFEMTMLNMSRVRD
GRIVEHWTISDNVTMLAQLGVKASL
selected fasta
>putative hydroxylase [hypothetical protein]
ATGGCTCATCAGCCTTCGGACACAATCGCCGGCCTTTACGAGGCGTTCAATTCCGGCGAC
CTGGAAACCCTGCGGGAGCTCATCGCCCCGGACGCCGTCATTCATCTGCCCGGGACGGCG
GGCGACGCCGAACACCCGCCGGGCACCCCCCGCGACCGCGAGGGGTGGCTGGGCGTGTGG
CAGTTCACCCAGGCGTTCTTCCCGGACATGACCGCGACCGTGCAGGACATCGTGCAGACC
GGCGACTTGGTGGCCACGCGGTGCGTCGCACGGGGAACGCACTCCATCGAGTTCATGGGG
GTCCCGCCGACCGGCCGGCCCTTCGAGATGACGATGCTCAACATGAGCCGGGTACGGGAC
GGCCGGATCGTCGAGCACTGGACGATCAGTGACAATGTCACCATGCTCGCGCAACTCGGC
GTGAAGGCGTCCCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009959 Polyketide cyclase SnoaL-like domain (Domain)
 [11-126]  5.09999999999998e-25 PF12680
PF12680   SnoaL_2
SignalP No significant hit
TMHMM No significant hit