close all open/close all

CDS information : Indano_00130


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction16,756 / 17,889 / + [in whole cluster]
16,756 / 17,889 / + [in contig]
Location16756..17889 [in whole cluster]
16756..17889 [in contig]
TypeCDS
Length1,134 bp (377 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative L-prolyl-PCP dehydrogenase
Product (GenBank)prolyl carrier protein dehydrogenase
Gene
Gene (GenBank)idmI
EC number
Keyword
  • pyrrole ring moiety
Note
Note (GenBank)
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)
Related Reference
ACC
Q9X3R3
NITE
Pyolu_00080
PmId
[11880032] Conversion of L-proline to pyrrolyl-2-carboxyl-S-PCP during undecylprodigiosin and pyoluteorin biosynthesis. (Chem Biol. , 2002)

close this sectionSequence

selected fasta
>putative L-prolyl-PCP dehydrogenase [prolyl carrier protein dehydrogenase]
MDFDLTEKQRQRYDDVLSAVRERLGEPPSGEPFTPARWQDAARIGLTGLCLPTEFGGGGL
GALDTALCLEAFGRGCPDTGLVFAVSAHLLACAVPIRDFADVSVRGELLSGLASGELVAA
NAMTEDDAGSDLSRLAVTAERKDDGYLLNGEKSFASNAPAADVLVTYGTSDPAAGFLGVT
AFVLRADLPGVQVGEPFRKMGLSGCPAGRVAFRDCHVPTSHRLGTEGQGSIIFQHSMGWE
RAILFAGYLGLMERQLEQCVRHARERRQFGHGIGEFQAVSHRVVGMKQRLEAARLLLYRA
CWLMDQGRDHSTAVALSKTAVSEGAVANSLDAIQIFGGSGYLSPAGIEQQLRDAVPSTIF
SGTTDIQREIVAREIGL
selected fasta
>putative L-prolyl-PCP dehydrogenase [prolyl carrier protein dehydrogenase]
GTGGATTTCGACCTCACCGAAAAACAGCGGCAACGCTATGACGACGTCTTGTCCGCAGTG
CGGGAGCGGCTCGGCGAGCCCCCCTCGGGCGAGCCGTTCACCCCTGCCCGATGGCAGGAC
GCGGCACGGATCGGCCTGACCGGCCTCTGCCTGCCGACCGAGTTCGGAGGCGGCGGTCTC
GGTGCGCTGGACACCGCGCTGTGCCTGGAGGCGTTCGGCCGGGGATGCCCCGACACCGGG
CTGGTGTTCGCCGTTTCCGCCCATCTGCTGGCCTGTGCCGTCCCGATCCGCGACTTCGCC
GACGTCTCGGTGCGCGGGGAGCTGCTGTCCGGGCTGGCGTCCGGAGAGCTCGTCGCCGCC
AATGCCATGACGGAGGACGACGCGGGTTCCGACCTGAGCCGTCTCGCCGTCACCGCGGAG
CGGAAGGACGACGGATACCTGCTGAACGGGGAGAAGTCGTTCGCCAGCAACGCCCCGGCC
GCCGATGTGCTCGTCACCTATGGCACGAGCGACCCCGCAGCGGGATTCCTCGGGGTCACG
GCCTTCGTGCTGCGCGCCGACCTGCCCGGTGTCCAAGTCGGTGAGCCCTTCCGCAAGATG
GGGCTCAGCGGCTGCCCCGCCGGCCGGGTCGCCTTCCGCGACTGCCACGTCCCCACCTCC
CACCGGCTCGGCACCGAGGGCCAGGGGAGCATCATCTTCCAGCACTCGATGGGCTGGGAA
CGCGCCATCCTGTTCGCCGGCTACCTCGGCCTGATGGAACGCCAGCTGGAGCAGTGCGTG
CGACATGCCCGCGAACGGCGCCAGTTCGGCCACGGCATCGGCGAGTTCCAGGCCGTCTCA
CACCGCGTCGTCGGCATGAAGCAGCGGCTGGAGGCCGCCCGGCTGCTGCTGTACCGCGCC
TGCTGGCTCATGGATCAGGGGCGTGACCACAGCACGGCGGTCGCCCTGTCCAAGACGGCC
GTCTCGGAGGGCGCGGTGGCCAACAGCCTCGACGCGATCCAGATCTTCGGGGGTTCCGGC
TATCTGAGCCCCGCCGGGATCGAACAGCAGCTCCGCGACGCCGTACCCAGCACGATCTTC
TCGGGGACCACGGACATTCAGCGCGAGATCGTCGCGAGGGAGATCGGCCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006090 Acyl-CoA oxidase/dehydrogenase, type 1 (Domain)
 [228-375]  1.09999999999999e-36 PF00441
PF00441   Acyl-CoA_dh_1
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [120-216]  5.90000000000001e-29 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
 [121-168]  1.2e-14 PF02770
PF02770   Acyl-CoA_dh_M
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [6-116]  5e-14 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [217-375]  3.80000000000003e-49 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
 [227-375]  4.90001027782408e-42 SSF47203
SSF47203   AcylCoADH_C_like
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [1-227]  8.79996401030972e-57 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [1-117]  1.1e-16 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP No significant hit
TMHMM No significant hit