close all open/close all

CDS information : Indano_00140


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction17,886 / 19,376 / + [in whole cluster]
17,886 / 19,376 / + [in contig]
Location17886..19376 [in whole cluster]
17886..19376 [in contig]
TypeCDS
Length1,491 bp (496 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative L-proline--PCP ligase
putative L-prolyl-PCP synthetase
Product (GenBank)proline adenyltransferase
Gene
Gene (GenBank)idmJ
EC number
Keyword
  • pyrrole ring moiety
Note
Note (GenBank)
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)
Related Reference
ACC
Q9X3R4
NITE
Pyolu_00090
PmId
[11880032] Conversion of L-proline to pyrrolyl-2-carboxyl-S-PCP during undecylprodigiosin and pyoluteorin biosynthesis. (Chem Biol. , 2002)

close this sectionPKS/NRPS Module

0
A28..417

close this sectionSequence

selected fasta
>putative L-proline--PCP ligase [proline adenyltransferase]
MNLHQLLVDTAAKEPDRLAVAGTAARLTYAELDSTANALAHRLRALGVGPGDRVVLWSDK
SPAVVAAMQAVLRLGAAYVPADGALPIARVAAMADDCSAAALLAPADRLAPVADVLGPRC
PAADLAQRPDPAAEPLNALVAPDDLAYILYTSGSTGAPKGVCISHRNARAFVDWAVEELA
PGPQDRFSNHAPFTFDLSVLDLYAAFSAGASVHLIPSELAYAPEQLVEFLHDRQITVWYS
VPSALTLMMRDGGLLDRPAPRALRTVLFAGEPFPLPGVRALAGWTDARLLNLYGPTETNV
CTRHEVRPTDLDGDRPLPIGTAVSGDRAWAEGPDGRLAAPGEEGELLVDGPTVMLGYWGG
EPHTGPYRTGDLVRPLPDGSFAYLGRRDHMVKVRGHRVELGEVESVLALHPDVAEAAAVV
VGSGMDGRLVAFVVPEPDRRPGVLSLVRHAAQRLPRYMVADEVRVLPGLPRTRNGKVDRL
ALRDTAEAPAPGAAAQ
selected fasta
>putative L-proline--PCP ligase [proline adenyltransferase]
GTGAACCTCCACCAGCTCCTCGTCGACACCGCCGCGAAGGAACCCGACCGGCTGGCCGTG
GCCGGAACCGCCGCCCGACTGACCTACGCGGAGCTCGACTCCACCGCCAACGCCCTCGCC
CACCGGCTGCGCGCCCTGGGCGTCGGGCCCGGTGACCGGGTCGTGCTGTGGTCGGACAAG
TCGCCGGCCGTCGTGGCCGCGATGCAGGCGGTGCTCCGCCTCGGCGCCGCCTACGTGCCC
GCCGACGGCGCCCTGCCGATCGCCCGGGTCGCCGCCATGGCCGACGACTGCTCGGCCGCC
GCGCTCCTGGCCCCGGCCGACCGTCTGGCGCCGGTCGCCGACGTGCTCGGCCCGCGGTGT
CCGGCCGCCGACCTCGCCCAGCGGCCCGACCCGGCCGCCGAACCCCTCAACGCGCTGGTG
GCGCCCGACGACCTGGCGTACATCCTCTACACCTCCGGATCGACCGGTGCTCCCAAAGGG
GTGTGCATCAGCCACCGCAACGCGCGCGCCTTCGTCGACTGGGCGGTCGAGGAGCTCGCC
CCCGGGCCGCAGGATCGCTTCTCCAACCATGCCCCGTTCACCTTCGACCTGTCCGTCCTG
GACCTGTACGCCGCGTTCTCGGCCGGCGCGTCGGTGCACCTGATTCCCTCCGAACTCGCC
TACGCACCGGAACAGTTGGTGGAGTTCCTGCACGACCGGCAGATCACGGTCTGGTACTCG
GTGCCGTCCGCCCTCACGCTGATGATGCGTGACGGGGGACTGTTGGACCGCCCCGCCCCC
CGAGCGCTGCGGACCGTGCTCTTCGCCGGGGAGCCCTTCCCCCTCCCGGGCGTCCGCGCG
CTGGCGGGTTGGACCGACGCCCGGCTGCTCAACCTCTACGGGCCCACCGAGACCAACGTC
TGTACCCGCCACGAGGTCCGCCCCACCGACCTCGACGGCGACCGGCCCCTGCCCATCGGC
ACCGCCGTCAGCGGCGACCGGGCCTGGGCCGAGGGCCCGGACGGGCGGCTCGCCGCACCC
GGCGAGGAGGGCGAACTGCTCGTCGACGGGCCGACGGTGATGCTCGGCTACTGGGGCGGG
GAACCGCACACCGGCCCCTACCGCACCGGCGACCTGGTCCGCCCGCTGCCCGACGGATCG
TTCGCCTACCTCGGCCGCCGCGATCACATGGTCAAAGTGCGCGGCCACCGGGTCGAACTG
GGCGAGGTCGAGTCCGTGCTCGCACTGCACCCGGACGTCGCGGAGGCGGCCGCCGTGGTC
GTGGGCAGCGGCATGGACGGCCGGCTGGTGGCGTTCGTGGTGCCCGAGCCGGACCGCCGT
CCCGGAGTGCTCTCGCTCGTACGGCACGCGGCGCAGCGGCTGCCGCGCTACATGGTCGCC
GACGAGGTGCGCGTACTGCCCGGGCTGCCCCGCACCCGCAACGGGAAGGTCGACCGCCTG
GCGCTGCGGGACACGGCCGAAGCCCCGGCCCCGGGCGCCGCCGCGCAGTGA
[0] A28..417
[0] A82..1251

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [28-417]  1.5e-97 PF00501
PF00501   AMP-binding
IPR010071 Amino acid adenylation domain (Domain)
 [28-417]  1.99999999999999e-102 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020459 AMP-binding (Domain)
 [143-154]  2.79999889404114e-05 PR00154 [155-163]  2.79999889404114e-05 PR00154
PR00154   AMPBINDING
IPR020845 AMP-binding, conserved site (Conserved_site)
 [148-159]  PS00455
PS00455   AMP_BINDING
IPR025110 Domain of unknown function DUF4009 (Domain)
 [457-487]  7.5e-06 PF13193
PF13193   DUF4009
SignalP No significant hit
TMHMM No significant hit