close all open/close all

CDS information : Indano_00150


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction19,428 / 19,703 / + [in whole cluster]
19,428 / 19,703 / + [in contig]
Location19428..19703 [in whole cluster]
19428..19703 [in contig]
TypeCDS
Length276 bp (91 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative peptidyl carrier protein
Product (GenBank)proline carrier protein
Gene
Gene (GenBank)idmK
EC number
Keyword
  • pyrrole ring moiety
Note
Note (GenBank)
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)
Related Reference
ACC
Q9X3R0
NITE
Pyolu_00030
PmId
[11880032] Conversion of L-proline to pyrrolyl-2-carboxyl-S-PCP during undecylprodigiosin and pyoluteorin biosynthesis. (Chem Biol. , 2002)

close this sectionPKS/NRPS Module

0
PCP15..81

close this sectionSequence

selected fasta
>putative peptidyl carrier protein [proline carrier protein]
MSQPVSEEETSKRITEFIRERFLDGDPQGELEPGSPLLEWGVLNSLRVARLIAFIRSDLG
VPVSAMEINPDNLRDVRSITAMVTRLARAGA
selected fasta
>putative peptidyl carrier protein [proline carrier protein]
ATGTCCCAGCCCGTGTCCGAGGAAGAGACGTCGAAACGCATCACCGAGTTCATCCGCGAG
CGGTTCCTCGACGGGGATCCGCAGGGCGAACTCGAACCCGGATCACCCCTGTTGGAGTGG
GGCGTCCTCAACTCCCTGCGCGTGGCGCGGCTGATCGCGTTCATCCGCAGTGACCTCGGC
GTCCCGGTGTCCGCGATGGAGATCAACCCGGACAACCTCCGCGACGTACGCAGCATCACC
GCGATGGTGACCCGTCTGGCCCGCGCCGGCGCCTGA
[0] PCP15..81
[0] PCP43..243

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [7-86]  4.1e-10 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [15-81]  0.00014 PF00550
PF00550   PP-binding
 [6-87]  3.79999862644791e-08 SSF47336
SSF47336   ACP_like
SignalP No significant hit
TMHMM No significant hit