close all open/close all

CDS information : Indano_00160


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction19,774 / 34,113 / + [in whole cluster]
19,774 / 34,113 / + [in contig]
Location19774..34113 [in whole cluster]
19774..34113 [in contig]
TypeCDS
Length14,340 bp (4,779 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
Gene
Gene (GenBank)idmL
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)

close this sectionPKS/NRPS Module

1 malonyl-CoA
not conserved HAFHS
2 malonyl-CoA
3 ethylmalonyl-CoA
KS13..387
AT568..884
ACP992..1062
KS1089..1455
AT1617..1940
KR2256..2436
ACP2550..2620
KS2649..3024
AT3179..3497
DH3545..3705
ER4023..4326
KR4336..4516
ACP4625..4695

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MVASPDVTFPPAEPIAVVGVGCRLPGGVRDLGSLGRMLRSGGTVLEEVPEDRWGRDLHDA
AEQDAPGTITHHVGAFLEDVDRFDAPYFGITPREAAAIDPQQRLLMEVASEAMADSGRAR
QDWRGTRTGVYVGLLANDYHLLHARSLGPQGVSPHYITGMEFSFAAGRLAYTFDLRGPAV
AVNSACSSSLYAVHQACQSLRAGDIDTALAGGVSLLLSPEISVFMSRIGAFSPSGRCRPF
DAEADGIVRGEGCGVVVLKRLADALADGDRVHAVIRGSAVNNDGSSVGLTAPNASAQAAV
VRSALAAARVGTDGVDYVEAHGTGTPLGDMIELGTLSEVYGAGRGDALPLVVGSHKAVFG
HTDAAAGITGLIKSIWILGAGHVPAQPGIDELTPAVDWDAGGIAVSLAGTDLTAPGRETA
SGQEASGQETASARPLRAGVSAFGLSGTNVHLIAEAPPRQEAPTDAPADGPTGRPHVLLV
SAPRPEGLVEQVARMREQLSRDDVPLTDLVASAATRRTHEDHRYAAVGTDRETLIEALDA
VTGPADLEDLPDGAYADRLDPAGEPAPVFVYSGQGSQWAGMAADLYGTDPDVTDTLDECD
ALIRTEASWSLLDELRRTDDSGLDRTDLAQPAIFAVQVALTRWLTRRGITPTAVIGHSVG
EIAAAHTAGVLPLPDAVRLIVRRGRILQDTAGTGRMLAVQGDPGTVADLLDGSGLPAVVA
AINGPASVVVAGPDDAVTEAQRLLEGHGLRCRRTRVDYPFHSPLVAECGPRLRDALAGLT
PARPTLRLLSSVDPDTDVGPLDAAYWARNITEPVRLWPAVDRLLAEDEAHTLLEIGPHPV
LLQPLADAARRRGLHRPVLSTLRRDEPGAVALHRTLARLHVTGTGVDWTTATGRPHRFRD
LPLPSWGGDRYWLPGVERGHHEPMRDRDAHPAVTEPPTTAPTGGTPARTTTAPTHETPGT
TAPTGGTPAPAAATAPADLPPPATAARSSARTVHRIDAVVREVLGLGPDQPLPRRRGLFE
QGLDSLTAVTLGKRLEEAFAVRLPSTVVFEHPSIQALAAHLAEATAAEPARHPSPEETPA
PAAASADDDAVAVIGMSCRLPGASSPEEFWSLLTEGRNAVAAPPPGRRDDPIWDEAGPDV
PTDGGYLADVSGFDAAFFHISPREAASLDPQQRLTLEVAWEALEDSGYPAAALLERQAGV
YVGLNTADYHELLTRDMANIDLYYGTGNTFAASAGRLSYFLGLHGPSLAVDTACSASLTA
VHLACQGLRAGDCEIALVGGANVIASPTVSVAMSAGGALAPDGRCKTFDEAADGYGRGEG
AVMLILKPLAAARRDGDRVYALLRGSAVNQDGDSGGFTVPSASAQSALIRQALDRAGWEP
REVDYVEAHGTGTPLGDPIEIHGLADALGPGRDAGNPLLVGSAKANIGHLEAAAGITGLL
KVVLSVHHGEIPPHLVDRPSSRIDWDALPVRLTTGRSPWPDRDRPRRAGVSSFGFSGSNA
HVLVEQAPHTADVPPAAEPADPPLALLPWVVSARGAAALRGQAARLARFVAAHPGLDPVD
ATYSLATTRSLLEHRAVVLARPGDQDTVRTALTALADGGSADDVISAGASGEGLTAFLFS
GQGSQRVGMGRQLYDRFPVFATALDEALAQLDRDGNGALRDILFAEPGTDAARLLDRTEY
TQSALFAVESALFRLLASWGLEPDYLMGHSIGELAAAHAAGVLSLSDAARLVTARGRLMQ
ALPEGGAMIAVAAPEAEVADALAASGHRDRLDIAAVNGRSSTVLSGDEEAAAALAAVLAA
RGHKTKRLRVSHAFHSPHMDAMLDDFREVAESVTYHAPHLPVISNVTGRLAEPGELCSAD
YWVRHVRAAVRFADGVRELDRLGVTTFLELGPDGVLAALSEESLDERPDAVAVPLLRKDR
PEDEAIITAVATAFVHGVKVNWQALLPRGRRVPLPTYAFQRRRHWLRRPEAPTAARPGPD
RPEARFWAAVDQGDRTELARALGLPEDGPSALDDLLPTLSAWRQGNRERTVLDSWRYRVV
WRPAPDTEPAPVTGTWLVLTSTHTADHPWTQHAVDALAERGAHVVHLPVDPARADRTALA
DLLTGATGDRPERGGVLSLLALDETPHPEHPDLAAGVTATLTLAQALGDADIDLPLWCVT
QGAVTVGGTDLVRRPEQAQIWGLGRVVGLEHPHRWGGLVDLPEQPDPHAVRHLCAALGAR
GPEDQLAVRATGTLVRRLVRAPLADTPAPRPWKPRGTVLVVGGTGALGGHLAHWLADHGA
ERLVLTGRRGSDAPGAAELRAELEAKGVLVTIAACDATDREALATVIERLRADGPPLRAV
LHTAVVADVGPLTETTVDRYAQAVRAKVVGGRNLDALLDTDELDAFVLFSSIAGVWGSGD
EGPYAAANAYLDALAERRRAGGLPATSVAWGIWDAFNDRDEDTSMRELLTRRSIRQGLPR
LDPRLAFQALRQALDHDETNVVVSDVTWERFAALFTMARPRPLLDEIPEARLVTTDENPD
PSDTDTGTDDGSELIRRLTGLPEAGQERLLLDVVCAQAASVLGHGSTEDLDTERPFRDLG
FDSLTAVELRRRLNQATGLRLPPSLVFDHPSPVALARHLRTELTAGQPHQDERPPSPTAK
AAPPDQEDDPIAIVGMACRLPGAIRSPEDLWQTVADGRDIVAGLPTDRGWDLERLYDADM
DAPGKSYVRHGAFLENAGDFDADFFGIAPREALAMDPQQRLLLETAWEAMERAGVTPASL
RGTQVGVFVGAGADGYATAENRVPEEAEGFAVTGSAGSVMSGRIAYTFGLEGPAVTVDTA
CSSSLVALHLASQALRAGECSMTLAGGVSLLASPKGLVEFSRLRALAPDGRSKAFSAAAD
GTGWGEGVGMLLLERLSDARRNGHRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRAAL
ANAGLTPGDVDAVEAHGTGTALGDPIEAQALLATYGQGRPEGRPLLLGSIKSNVAHPQAA
AGVTGVIKMVMALRNGVLPKTLHAEEPSPHVDWSAGDVELLTEAREWPQVERPWRAGVSS
FGMSGTNAHVIVEQAPESSVEEVGERVPVGVVPWVVSARSAEGLAGQAERLLELIDRRPE
LDPVDVGFSLAVSRSVLERRAVVLGRGREDLTAGLEALVSGEPSAGVVSGVGDVRGRVVF
VFPGQGSQWVGMAVELLESSVVFGDVFAECDRVLGALTGWSVVDVVRGVVGAPSLERIEV
LQPVLFAVQVSLARLWGSVGVVPAAVVGHSQGEVAAAYVAGALSLEDAARVVVRRSDLFA
RELVGRGAVASVALGAVEVEERLAGWGGRLSVAGRNGPAAVTVAGEVAALEEFVASCRGE
GVRARVLGSTVASHSVQVDALRERIVELFADIVPRASRVPMYSTVTGRVIDTVGLDAGYW
FDNARRPVDYEGAVRALVADGFRFFVEASAHPVLTVGTQATCEDVGVEVVAVGSLRRGEG
GLGRFVASVAEAFTRGLVVDWAGLLAGGRRVELPTYAFQRRRFWLEDAAVAGGDAGVWGL
AAAEHPLLGAAVHLADGEGVVLTGRVSLRTHPWLVDHAVAGTVLLPGTAFVELAIRAGDE
AGCGRLDELTLEAPLVVPEDRSVSIQVRVGAEDEAGLRRVSVHSLTGEGQDWVRHADGVL
APDDTAEVFDLAVWPPADAEPVPLEGFYEGLTESGYGYGPVFQGLRAAWRRGEELFAEVS
LPEDVADGASGFGLHPALLDAALHVGLTDAGQAGRVRLPFVWSGVTLFAQGASSVRVRLL
PTGEDSVSVQVADVEGTPVASADAVVTRLAVPGQFSHPSSGEQDSLFRIDWTPLKPGDEV
SPDRWTVLDEGAAGPDAESLPEFVVLPCGTGASEPASGASGGLTHAVRQATAGMLTFLQQ
WLSEERCTDSRLVVVTRGALGATPGDAVPDLAHAPVWGLVRSAQTENPGRFVLVDLEAGT
DADAALAEVLPRVLGSGEPQVVVRAGRVLAARLTRSTTARSSTDGALVPPVGTSWRLDLT
TPGTLENLRLVPCTPEPLGPLDVRIAVRAAGLNFRDVLIALGMYPDPGAMGGEAAGVVTE
VGSEVTGLEPGDRVMGIVPLSFGPDAVTDSRTVVRIPEGWTFEQAASVPVAFVTAYYGLV
DLAGVRAGESVLVHAAAGGVGMAAVQLARHLGAEVFGTASPAKWDTLRAGGLDDGHIASS
RTLDFEDTFRTATGGRGVDVVLNSLAGEFVDASLRLLPRGGRFVEMGKADIRDAEQVAAE
HSGVAYRFYEMMEAGPQRTQEILREIVALFERGVLTQLPVTAWDVRRAAEAFRFVSQARH
IGKNVLTMPPVWDPDGTVLITGGTGALGALVAQHVVAEHGIRHLLLAGRRGVEAPGAREL
LAELEAAGADVSVVACDVADRDAVAELVAKVPSEHPLTAVVHTAGVLADGTIAALDAERV
DTVMRPKVDAVLNLHEATRDLDLAGFVLFSSASGALGSPGQGNYAAANSFLDAFAHHRRV
QGLPAVSLAWGLWAEASGMTGEFKGDDVARISRSGLAPLTNAQGMALLDTSLTLDEALLV
PVRLDPAGLRAQAGAGTVPSLLRGLVRTPGRRVATSKAGRSSGQEVSALLQRLVQLSHED
RTRALLDLVRSHAATTLGHAKPDAVEAERGFLDLGFDSLTAVELRNRLNTAVGLRLPATL
IFDHPTPAALAHHLRTELVPDEGEATGDAPRFTSDSGAGDEGRSAEETTLAVDDMDIADL
IRMAHGELGTTEQQQADASTQFEAPGHNGGPGRSEGQSS
selected fasta
>polyketide synthase [polyketide synthase]
ATGGTCGCCAGCCCGGACGTGACCTTCCCTCCCGCAGAGCCCATCGCCGTCGTCGGCGTG
GGGTGCCGCCTCCCGGGCGGCGTACGTGACCTCGGCTCGCTCGGCAGGATGCTCAGGTCC
GGCGGCACCGTCCTCGAAGAGGTCCCCGAGGACCGCTGGGGACGGGACCTGCACGACGCC
GCCGAGCAGGACGCCCCCGGCACCATCACCCATCACGTCGGCGCCTTCCTGGAGGACGTC
GACCGGTTCGACGCGCCCTACTTCGGCATCACACCCCGCGAGGCGGCCGCCATCGACCCC
CAGCAGCGCCTGCTGATGGAGGTCGCCTCCGAGGCGATGGCCGACTCCGGCCGGGCGCGC
CAAGACTGGCGCGGCACCCGCACCGGCGTCTACGTCGGTCTGCTCGCCAACGACTACCAC
CTGCTGCACGCCAGGTCGCTCGGCCCGCAGGGCGTCAGCCCGCACTACATCACCGGCATG
GAGTTCAGCTTCGCCGCGGGCCGGCTGGCCTACACCTTCGACCTGCGCGGCCCCGCCGTC
GCGGTCAACTCGGCATGCTCGTCGTCCCTGTACGCCGTCCACCAGGCGTGCCAGAGCCTG
CGCGCCGGCGACATCGACACCGCCCTCGCCGGCGGCGTCAGCCTGCTGCTCAGCCCCGAG
ATCAGTGTCTTCATGAGCCGGATCGGCGCGTTTTCCCCGTCGGGGCGCTGCCGCCCCTTC
GACGCGGAGGCCGACGGCATCGTCCGCGGCGAGGGCTGCGGCGTCGTGGTGCTCAAGCGG
CTGGCGGACGCGCTCGCCGACGGCGACCGCGTCCACGCGGTCATCCGCGGTTCCGCCGTC
AACAACGACGGCAGCAGCGTCGGCCTGACCGCCCCGAACGCCTCCGCCCAGGCCGCCGTG
GTGCGGTCGGCGCTGGCCGCGGCCCGCGTGGGCACCGACGGCGTCGACTACGTCGAGGCG
CACGGCACCGGCACACCCCTCGGGGACATGATCGAGCTCGGCACCCTGTCCGAGGTGTAC
GGAGCGGGACGCGGCGATGCCCTCCCGCTGGTGGTCGGCTCGCACAAGGCGGTCTTCGGG
CACACCGACGCCGCGGCCGGCATCACCGGCCTCATCAAGTCGATCTGGATTCTCGGCGCC
GGACACGTGCCGGCCCAGCCCGGCATCGACGAGCTCACCCCGGCCGTCGACTGGGACGCG
GGCGGCATCGCCGTCTCGCTCGCCGGCACAGACCTGACCGCCCCCGGCAGGGAGACGGCC
TCCGGTCAAGAAGCCTCCGGTCAGGAGACGGCCTCCGCGCGCCCGCTGCGGGCCGGTGTC
AGCGCCTTCGGGCTCAGCGGCACCAACGTCCACCTCATCGCCGAGGCCCCGCCGCGGCAG
GAGGCACCGACCGACGCGCCGGCCGACGGCCCCACCGGGAGGCCGCACGTCCTGCTCGTC
TCCGCGCCCCGACCGGAAGGCCTGGTCGAACAGGTCGCCCGGATGCGGGAGCAGCTCTCC
CGCGACGACGTGCCGCTCACCGACCTCGTCGCGTCCGCGGCGACCCGGCGCACCCACGAG
GACCACCGGTACGCAGCCGTCGGCACCGACCGCGAGACGCTGATCGAAGCCCTGGACGCG
GTCACCGGCCCCGCGGACCTCGAAGACCTGCCCGACGGCGCGTACGCGGACCGGCTGGAC
CCCGCCGGCGAACCGGCCCCCGTCTTCGTCTACTCCGGACAGGGCAGCCAGTGGGCCGGC
ATGGCCGCCGACCTGTACGGCACCGACCCCGACGTCACCGACACCCTCGACGAGTGCGAC
GCGCTGATCCGCACCGAGGCGTCCTGGTCGCTTCTCGACGAACTGCGGCGCACCGACGAC
AGCGGACTCGACCGCACCGACCTCGCCCAGCCGGCCATCTTCGCCGTCCAGGTGGCGCTG
ACCCGCTGGCTCACCCGGCGCGGCATCACCCCGACGGCCGTCATCGGCCACAGCGTCGGC
GAGATAGCCGCCGCCCACACCGCGGGCGTCCTCCCCCTGCCCGACGCCGTACGGCTGATC
GTCCGGCGCGGACGGATCCTGCAGGACACCGCGGGAACCGGGCGCATGCTCGCGGTGCAG
GGCGACCCCGGCACGGTCGCCGACCTCCTCGACGGCAGCGGCCTCCCGGCCGTGGTCGCC
GCGATCAACGGCCCCGCCTCCGTCGTCGTCGCCGGGCCCGACGACGCCGTCACCGAGGCG
CAGCGCCTGCTCGAAGGACACGGTCTGCGCTGCCGCCGCACCCGCGTCGACTACCCCTTC
CACAGCCCTCTCGTCGCCGAGTGCGGCCCGCGCCTGCGCGACGCACTCGCCGGTCTCACC
CCGGCGCGGCCCACCCTGCGCCTGCTCTCCAGCGTCGACCCCGACACCGACGTCGGCCCG
CTCGACGCCGCCTACTGGGCCCGCAACATCACCGAACCCGTACGGCTGTGGCCCGCCGTC
GACCGTCTGCTCGCCGAGGACGAGGCCCACACCCTCCTGGAGATCGGCCCTCACCCGGTC
CTGCTGCAGCCGCTCGCCGACGCCGCACGCCGGCGCGGCCTGCACCGTCCCGTGCTGAGC
ACCCTGCGCCGCGACGAACCGGGCGCGGTGGCGCTCCACCGGACCCTGGCCCGCCTGCAC
GTCACCGGCACCGGCGTGGACTGGACGACGGCCACCGGCAGGCCGCACCGCTTCCGGGAC
CTGCCGCTGCCTTCCTGGGGCGGCGACCGGTACTGGCTGCCCGGCGTGGAGCGCGGACAC
CACGAGCCGATGCGGGACCGGGACGCGCACCCGGCGGTCACGGAACCGCCCACCACCGCC
CCGACCGGCGGCACGCCGGCCCGGACCACCACCGCCCCGACCCACGAGACGCCGGGCACC
ACCGCCCCGACCGGCGGGACGCCGGCCCCGGCCGCGGCGACCGCACCGGCCGACCTGCCC
CCGCCCGCCACCGCCGCGCGCTCCTCCGCCCGGACGGTGCACCGGATCGACGCCGTCGTC
CGTGAGGTGCTCGGGCTCGGCCCCGACCAGCCGCTGCCCCGCCGACGCGGCCTGTTCGAA
CAGGGGCTGGACTCGCTGACCGCGGTCACCCTCGGCAAGCGGCTCGAAGAGGCCTTCGCG
GTACGGCTCCCGTCCACCGTCGTCTTCGAGCACCCGTCGATCCAGGCACTGGCCGCCCAC
CTCGCGGAAGCGACGGCGGCCGAGCCCGCACGGCACCCGTCACCCGAGGAGACACCCGCA
CCGGCGGCGGCGAGCGCGGACGACGACGCCGTCGCGGTGATCGGCATGTCCTGCCGCCTG
CCGGGAGCGTCCTCGCCCGAGGAGTTCTGGTCCCTGCTGACCGAGGGCCGGAACGCCGTG
GCGGCCCCGCCGCCCGGGCGGCGGGACGACCCGATCTGGGACGAGGCCGGACCCGATGTC
CCCACCGACGGCGGCTACCTGGCCGACGTCTCCGGGTTCGACGCCGCGTTCTTCCACATC
TCCCCCCGCGAGGCGGCCTCGCTCGACCCGCAGCAGCGGCTCACGCTGGAGGTGGCCTGG
GAGGCACTGGAGGACTCCGGCTACCCCGCGGCCGCCCTGCTGGAGCGTCAGGCAGGTGTG
TACGTCGGCCTCAACACGGCCGACTACCACGAACTGCTCACCCGCGACATGGCCAACATC
GACCTCTACTACGGCACCGGAAACACCTTCGCCGCCTCCGCCGGCCGACTGTCGTACTTC
CTCGGGCTGCACGGGCCCAGCCTCGCCGTGGACACCGCCTGCTCGGCGTCCCTGACCGCG
GTACACCTCGCCTGCCAGGGACTGCGGGCCGGTGACTGCGAGATCGCCCTCGTCGGCGGT
GCCAACGTCATCGCCTCCCCGACGGTGTCCGTGGCCATGTCCGCGGGCGGCGCCCTCGCC
CCCGACGGCCGTTGCAAGACCTTCGACGAGGCCGCCGACGGATACGGCCGCGGCGAGGGC
GCCGTCATGCTCATCCTCAAACCGCTGGCCGCGGCGCGCCGCGACGGCGACCGGGTCTAC
GCCCTGCTGCGCGGCAGCGCCGTCAACCAGGACGGGGACAGCGGCGGGTTCACCGTGCCG
AGCGCGTCCGCGCAGTCCGCCCTGATCCGGCAGGCGCTGGACCGGGCCGGCTGGGAGCCC
CGCGAGGTCGACTACGTGGAGGCCCACGGCACCGGCACCCCCCTGGGCGACCCCATCGAG
ATACACGGCCTGGCCGACGCCCTCGGCCCGGGCCGCGACGCCGGCAACCCGCTGCTCGTC
GGCTCGGCCAAGGCGAACATCGGACACCTGGAAGCCGCCGCCGGTATCACCGGACTGCTC
AAGGTCGTCCTTTCCGTGCACCACGGTGAGATACCGCCGCACCTCGTCGACCGCCCCTCC
AGCCGCATCGACTGGGACGCCCTGCCCGTGCGACTCACCACCGGCCGTTCCCCCTGGCCC
GACCGGGACCGCCCGCGCCGGGCCGGGGTCTCCTCCTTCGGCTTCAGCGGCAGCAACGCC
CACGTCCTCGTCGAACAGGCGCCCCACACCGCCGACGTCCCGCCCGCCGCCGAACCCGCA
GACCCGCCCCTCGCGCTGCTGCCCTGGGTGGTCTCCGCCCGTGGCGCGGCCGCCCTGCGG
GGACAGGCCGCCAGGCTGGCCCGGTTCGTCGCCGCCCACCCCGGCCTCGACCCCGTGGAC
GCCACGTACTCATTGGCCACCACCCGGTCTCTGCTGGAGCACCGCGCCGTGGTCCTCGCC
AGGCCCGGCGACCAGGACACCGTACGTACCGCCCTCACCGCGCTCGCCGACGGCGGCAGC
GCCGACGACGTGATCAGCGCCGGCGCCTCGGGGGAGGGGCTCACCGCATTCCTGTTCAGC
GGGCAGGGCAGCCAACGCGTCGGGATGGGACGGCAGTTGTACGACCGCTTCCCCGTGTTC
GCCACTGCCCTCGACGAGGCCCTGGCCCAGCTGGACCGCGACGGGAACGGCGCGCTGCGC
GACATCCTGTTCGCCGAGCCCGGCACGGACGCGGCCCGGCTGCTCGACCGGACCGAGTAC
ACCCAGAGCGCGCTGTTCGCCGTGGAGAGCGCCCTGTTCCGGCTTCTGGCCAGTTGGGGC
CTCGAACCCGACTACCTGATGGGCCACTCGATCGGCGAACTGGCCGCCGCCCACGCCGCC
GGCGTGCTCTCGCTGAGCGACGCGGCCAGGCTGGTGACCGCCCGCGGCCGGCTGATGCAG
GCCCTGCCCGAGGGCGGCGCCATGATCGCCGTCGCCGCACCGGAGGCCGAGGTCGCCGAC
GCCCTCGCCGCGTCCGGCCACCGCGACCGGCTCGACATCGCCGCCGTCAACGGACGCTCC
TCCACCGTGCTCTCCGGCGACGAGGAAGCGGCGGCCGCTCTGGCCGCGGTACTCGCCGCG
CGCGGCCACAAGACCAAGCGCCTGCGCGTCAGCCACGCCTTCCACTCGCCGCACATGGAC
GCCATGCTCGACGACTTCCGGGAGGTCGCCGAGAGCGTCACCTACCACGCGCCGCACCTG
CCCGTGATCTCCAACGTCACCGGCCGGCTCGCCGAGCCCGGCGAGCTGTGCTCGGCGGAC
TACTGGGTACGGCACGTCCGGGCCGCGGTCCGCTTCGCCGACGGCGTTCGGGAACTCGAC
CGCCTCGGCGTGACCACCTTCCTGGAACTGGGCCCGGACGGGGTGCTCGCCGCCCTGAGC
GAGGAATCCCTCGACGAACGGCCGGACGCGGTCGCCGTCCCGCTGCTGCGCAAGGACCGC
CCCGAGGACGAGGCGATCATCACCGCCGTGGCCACCGCCTTCGTCCACGGAGTGAAGGTG
AACTGGCAGGCCCTGCTGCCCCGCGGCCGACGCGTCCCGCTGCCCACCTACGCCTTCCAG
CGGCGCCGCCACTGGCTCCGGCGCCCCGAAGCCCCCACGGCTGCCCGCCCCGGTCCCGAC
CGGCCCGAGGCCCGCTTCTGGGCGGCCGTCGACCAGGGCGACCGCACGGAACTCGCCCGC
GCCCTCGGCCTGCCCGAGGACGGCCCGTCCGCGCTGGACGACCTGCTGCCGACCCTGTCC
GCCTGGCGGCAGGGCAACCGGGAACGAACCGTCCTGGACTCGTGGCGCTACCGGGTCGTC
TGGCGGCCCGCCCCCGACACGGAACCGGCGCCGGTCACCGGCACCTGGCTCGTTCTCACC
TCCACCCACACCGCCGACCACCCGTGGACACAGCACGCCGTCGACGCCCTCGCCGAACGC
GGCGCCCACGTCGTCCACCTCCCCGTCGACCCGGCGCGCGCCGACCGCACGGCACTCGCC
GACCTGCTGACCGGGGCCACCGGCGACCGCCCGGAGCGGGGCGGTGTCCTCTCCCTGCTC
GCCCTCGACGAGACCCCGCACCCCGAACACCCCGACCTCGCGGCCGGCGTCACCGCCACC
CTCACCCTCGCGCAGGCCCTCGGCGACGCCGACATCGACCTGCCCCTGTGGTGCGTCACC
CAAGGCGCCGTCACCGTCGGCGGAACCGATCTTGTCCGGCGCCCCGAACAGGCCCAGATC
TGGGGCCTGGGCCGCGTCGTCGGCCTGGAACACCCCCACCGCTGGGGCGGCCTCGTAGAT
CTCCCCGAACAGCCCGACCCGCACGCCGTACGCCATCTGTGCGCCGCACTCGGCGCCCGC
GGCCCCGAGGACCAACTGGCCGTACGCGCCACCGGCACCCTCGTACGACGCCTGGTGCGC
GCCCCCCTCGCCGACACCCCCGCACCACGACCGTGGAAGCCCCGCGGCACCGTGCTCGTC
GTCGGCGGCACCGGAGCCCTCGGCGGCCACCTCGCCCACTGGCTCGCCGACCACGGCGCC
GAACGCCTCGTCCTCACCGGCCGCCGGGGATCCGACGCCCCCGGCGCCGCCGAACTGCGC
GCCGAACTCGAGGCCAAGGGCGTTCTCGTCACCATCGCCGCCTGCGACGCCACGGACCGC
GAGGCACTCGCCACCGTGATCGAGCGGCTGCGCGCCGACGGACCGCCCCTGCGCGCGGTC
CTGCACACCGCCGTCGTCGCCGACGTCGGCCCGCTCACCGAGACGACCGTCGACCGCTAC
GCACAGGCCGTACGCGCCAAGGTCGTCGGCGGCCGCAACCTCGACGCCCTCCTCGACACC
GACGAACTCGACGCGTTCGTGCTGTTCTCCTCCATCGCGGGCGTGTGGGGCAGCGGCGAC
GAAGGCCCCTACGCGGCCGCCAACGCCTACCTCGACGCGCTCGCCGAACGCCGTCGGGCC
GGCGGCCTGCCCGCCACCTCCGTCGCCTGGGGCATCTGGGACGCCTTCAACGACCGCGAC
GAGGACACCTCCATGCGCGAGCTGCTCACCCGGCGCTCGATCCGCCAGGGCCTGCCCCGT
CTCGACCCGCGCCTCGCCTTCCAGGCCCTGCGGCAGGCACTCGACCACGACGAGACGAAC
GTCGTCGTCAGCGACGTCACCTGGGAACGCTTCGCCGCCCTGTTCACCATGGCCCGCCCG
CGCCCCCTGCTCGACGAGATCCCCGAGGCGCGCCTCGTCACCACCGACGAGAATCCCGAC
CCCTCGGACACCGACACCGGCACGGACGACGGATCCGAGCTGATCCGTCGCCTCACCGGT
CTCCCGGAGGCCGGTCAGGAACGCCTCCTCCTCGACGTGGTGTGCGCACAGGCGGCCTCC
GTACTCGGCCACGGCAGCACCGAGGACCTCGACACCGAACGCCCCTTCCGCGACCTCGGT
TTCGACTCCCTCACCGCCGTCGAACTGCGCCGCCGCCTCAACCAGGCAACCGGCCTGCGT
CTGCCGCCCTCCCTCGTCTTCGACCACCCCAGCCCCGTGGCCCTCGCCCGCCACCTGCGG
ACCGAACTCACGGCCGGACAGCCGCACCAGGACGAGCGGCCCCCGTCGCCCACGGCCAAG
GCAGCGCCGCCGGACCAGGAGGACGACCCCATCGCCATCGTCGGCATGGCCTGCCGCCTG
CCCGGTGCCATCCGCTCCCCGGAAGACCTGTGGCAGACCGTCGCCGACGGCCGTGACATC
GTCGCCGGACTGCCCACCGACCGCGGCTGGGACCTCGAACGGCTCTACGACGCCGACATG
GACGCCCCCGGCAAGAGCTACGTACGCCACGGCGCGTTCCTCGAGAACGCCGGCGACTTC
GACGCCGACTTCTTCGGCATCGCACCGCGTGAAGCACTCGCCATGGACCCCCAGCAGCGG
CTGCTCCTGGAGACCGCCTGGGAGGCCATGGAGCGCGCCGGAGTGACCCCGGCCTCCCTG
CGCGGCACCCAGGTCGGCGTCTTCGTCGGCGCGGGCGCCGACGGATACGCCACCGCCGAG
AACCGCGTTCCGGAAGAGGCCGAGGGCTTCGCCGTCACGGGCAGCGCCGGAAGCGTCATG
TCCGGCCGGATCGCCTACACCTTCGGCCTCGAAGGGCCGGCGGTGACCGTGGACACGGCC
TGCTCGTCGTCTCTGGTGGCCCTCCACCTCGCGAGCCAGGCCCTGCGCGCCGGCGAGTGC
TCCATGACCCTCGCCGGCGGTGTCTCCCTGCTCGCCAGCCCCAAGGGCCTCGTCGAGTTC
AGCCGCCTGCGTGCCCTGGCGCCCGACGGCCGGTCGAAGGCGTTCTCGGCGGCGGCCGAC
GGTACGGGCTGGGGTGAGGGTGTGGGGATGCTGCTGTTGGAGCGGTTGTCGGACGCCCGG
CGCAACGGGCACCGGGTCCTGGCCGTCGTGCGGGGCTCGGCGGTGAACCAGGACGGTGCG
AGCAACGGCCTGACCGCGCCGAACGGTCCGTCCCAGCAGCGTGTCATCCGGGCCGCGTTG
GCCAACGCCGGCCTGACCCCCGGTGACGTCGACGCCGTCGAGGCCCATGGCACGGGTACG
GCCCTGGGCGACCCGATCGAGGCCCAGGCGCTGCTCGCCACCTACGGCCAAGGGCGCCCC
GAGGGGCGGCCGTTGCTGCTCGGCTCGATCAAGTCGAACGTCGCCCACCCCCAGGCCGCG
GCCGGTGTCACCGGCGTCATCAAGATGGTGATGGCCCTGCGCAACGGGGTGCTGCCGAAG
ACGCTGCACGCCGAGGAGCCGTCGCCGCACGTCGACTGGTCCGCGGGCGACGTGGAGTTG
CTGACCGAGGCCCGCGAGTGGCCGCAGGTCGAGCGCCCCTGGCGGGCTGGTGTGTCCTCG
TTCGGGATGAGCGGGACGAACGCGCACGTGATCGTGGAGCAGGCGCCGGAGTCGTCCGTC
GAGGAGGTGGGTGAGCGGGTTCCGGTCGGGGTGGTGCCGTGGGTGGTGTCGGCGCGGAGC
GCTGAGGGACTGGCCGGCCAGGCGGAGCGGCTGCTCGAACTCATCGACAGGCGACCGGAG
CTGGATCCGGTCGATGTCGGGTTCTCACTGGCGGTGTCGCGCTCGGTGCTGGAGCGGCGG
GCGGTGGTGCTGGGCCGCGGCCGGGAGGACCTGACGGCGGGCCTGGAGGCGTTGGTCTCC
GGTGAACCGAGTGCGGGTGTGGTGTCGGGTGTGGGTGATGTGCGGGGTCGGGTGGTGTTT
GTTTTCCCTGGTCAGGGGTCGCAGTGGGTGGGTATGGCGGTGGAGTTGCTGGAGTCGTCG
GTGGTGTTCGGGGACGTGTTTGCCGAGTGTGACCGGGTGTTGGGGGCGTTGACGGGGTGG
TCGGTGGTGGATGTGGTGCGGGGGGTGGTGGGTGCGCCGTCGCTGGAGCGGATCGAGGTG
TTGCAGCCGGTGTTGTTCGCGGTGCAGGTGTCGTTGGCGCGGTTGTGGGGGTCGGTGGGG
GTGGTGCCGGCTGCGGTGGTGGGTCATTCGCAGGGTGAGGTGGCGGCGGCGTATGTGGCG
GGTGCTTTGTCGCTGGAGGATGCGGCGCGGGTGGTGGTGCGGCGCAGTGATCTGTTCGCG
CGGGAGTTGGTGGGTCGGGGTGCGGTGGCGTCGGTGGCGTTGGGTGCGGTTGAGGTGGAG
GAGCGGCTTGCGGGCTGGGGTGGGCGGTTGAGTGTGGCGGGGCGTAATGGTCCGGCTGCG
GTGACGGTTGCGGGTGAGGTGGCGGCGTTGGAGGAGTTCGTGGCTTCGTGCCGGGGGGAG
GGGGTGCGGGCGCGGGTGCTGGGTTCGACGGTGGCGTCGCATTCGGTGCAGGTGGATGCG
TTGCGTGAGCGGATTGTGGAGTTGTTCGCGGATATTGTTCCGCGGGCTTCGCGGGTGCCG
ATGTATTCGACGGTGACGGGGCGGGTGATCGACACCGTTGGGCTGGATGCGGGGTATTGG
TTCGACAATGCGCGCCGGCCGGTGGATTACGAGGGTGCGGTGCGGGCGCTGGTGGCTGAT
GGTTTTCGTTTCTTCGTGGAGGCGAGTGCGCATCCGGTGTTGACGGTGGGTACGCAGGCG
ACGTGTGAGGACGTGGGTGTCGAGGTGGTGGCGGTGGGGTCGCTGCGTCGGGGTGAGGGG
GGTTTGGGCCGGTTCGTGGCGTCGGTGGCGGAGGCGTTCACGCGGGGTCTGGTGGTGGAC
TGGGCGGGGTTGCTGGCGGGTGGTCGGCGGGTGGAGTTGCCGACGTATGCCTTTCAGCGG
CGGCGCTTTTGGCTGGAGGACGCTGCGGTGGCGGGTGGTGATGCGGGTGTGTGGGGGCTT
GCGGCGGCTGAGCATCCGTTGCTGGGTGCGGCGGTGCATCTGGCCGACGGTGAGGGTGTG
GTGCTGACGGGTCGGGTGTCGTTGCGGACGCATCCGTGGCTGGTGGATCACGCGGTGGCG
GGGACGGTTCTGCTGCCGGGTACGGCGTTCGTGGAGCTGGCGATCCGGGCCGGTGACGAG
GCCGGCTGCGGACGACTCGACGAACTCACCCTCGAAGCACCGCTCGTCGTGCCCGAAGAC
CGTTCGGTCTCGATCCAGGTGCGGGTCGGGGCCGAGGACGAGGCGGGGCTCCGGCGGGTC
AGCGTGCACTCCCTCACGGGGGAGGGTCAGGACTGGGTCCGCCATGCCGACGGTGTGCTC
GCCCCGGACGACACGGCGGAGGTGTTCGACCTCGCGGTGTGGCCCCCGGCCGACGCCGAG
CCGGTTCCGCTGGAGGGCTTCTACGAGGGCCTGACCGAGTCCGGCTACGGCTACGGGCCG
GTGTTCCAGGGCCTGCGGGCGGCCTGGCGGCGCGGCGAGGAACTCTTCGCCGAGGTGAGC
CTCCCCGAGGACGTCGCGGACGGTGCGTCCGGCTTCGGCCTCCACCCGGCGCTGCTGGAC
GCGGCTCTCCATGTCGGGCTCACGGACGCGGGACAGGCCGGCCGAGTGCGGTTGCCGTTC
GTGTGGAGCGGGGTGACGCTGTTCGCCCAGGGCGCCTCCAGCGTGCGCGTGCGGCTGCTG
CCCACGGGCGAGGACTCCGTCTCCGTACAGGTCGCCGACGTCGAAGGCACTCCGGTCGCG
TCCGCCGACGCCGTCGTCACCCGCCTTGCGGTCCCGGGCCAGTTCAGCCACCCGTCCAGT
GGGGAACAGGACTCGCTCTTCAGGATCGACTGGACACCGCTGAAGCCGGGCGACGAGGTG
TCACCGGACCGGTGGACGGTGCTGGACGAGGGCGCCGCCGGACCGGACGCCGAGAGCCTC
CCGGAATTCGTGGTCCTCCCCTGTGGGACGGGAGCCTCCGAGCCCGCCTCCGGCGCGAGC
GGCGGTCTCACGCACGCGGTACGTCAAGCCACCGCCGGAATGCTGACGTTCCTTCAGCAG
TGGCTCTCCGAGGAACGCTGCACCGACTCACGCCTGGTCGTGGTGACCCGGGGAGCGCTG
GGCGCGACCCCCGGCGATGCCGTACCGGATCTGGCGCATGCCCCGGTGTGGGGTCTGGTG
CGGTCGGCGCAGACCGAGAATCCGGGCCGGTTCGTGCTCGTGGACCTGGAAGCCGGTACT
GACGCGGACGCCGCCCTGGCCGAGGTGCTGCCCAGGGTGCTGGGCTCCGGTGAACCGCAG
GTGGTGGTGCGTGCCGGACGCGTGCTGGCGGCGCGTCTGACGCGGTCGACGACCGCGCGG
TCGTCGACGGACGGTGCGCTGGTGCCACCGGTCGGCACATCCTGGCGACTGGACCTGACG
ACCCCGGGCACACTGGAGAACCTGAGGCTGGTGCCCTGCACGCCGGAGCCGTTGGGTCCG
CTCGATGTGCGGATCGCCGTACGCGCTGCCGGCCTCAACTTCCGTGACGTGCTGATCGCT
CTCGGCATGTACCCGGACCCCGGCGCGATGGGCGGCGAGGCGGCCGGTGTCGTCACGGAG
GTCGGTTCCGAGGTCACCGGCCTGGAACCGGGGGACCGCGTGATGGGCATCGTCCCGCTG
TCCTTCGGACCGGACGCGGTCACCGACTCCCGGACCGTGGTGCGCATCCCCGAGGGCTGG
ACCTTCGAGCAGGCCGCGTCGGTCCCGGTCGCCTTCGTCACCGCCTACTACGGGCTGGTG
GACCTGGCCGGGGTGCGGGCGGGGGAATCGGTGCTGGTGCACGCGGCGGCGGGCGGTGTC
GGGATGGCCGCCGTGCAGCTCGCCCGGCACCTGGGCGCGGAGGTCTTCGGTACGGCGAGT
CCGGCGAAGTGGGACACGCTGCGAGCCGGCGGTCTCGACGACGGACACATCGCGTCCTCC
CGGACGCTCGACTTCGAGGACACGTTCCGCACGGCCACGGGCGGGCGCGGCGTGGACGTC
GTGTTGAACAGCCTGGCCGGTGAGTTCGTCGACGCGTCGCTGCGGCTGCTGCCGCGCGGC
GGACGCTTCGTCGAGATGGGCAAGGCCGACATACGGGACGCGGAGCAGGTCGCTGCCGAG
CACTCCGGCGTCGCCTACCGCTTCTACGAGATGATGGAAGCGGGCCCGCAGCGCACTCAG
GAGATCCTCCGCGAGATCGTGGCACTCTTCGAGCGTGGGGTGTTGACGCAGCTGCCGGTG
ACTGCGTGGGACGTGCGGCGGGCGGCGGAGGCCTTCCGGTTCGTCAGCCAGGCGCGGCAT
ATCGGCAAGAACGTGCTGACGATGCCGCCCGTGTGGGACCCGGACGGCACCGTGTTGATC
ACGGGCGGCACGGGCGCCCTGGGCGCGTTGGTGGCCCAGCACGTGGTGGCCGAACACGGG
ATACGCCACCTGCTGCTGGCCGGCCGGAGGGGCGTGGAGGCGCCCGGAGCACGGGAGCTG
CTGGCCGAACTGGAAGCGGCCGGTGCGGATGTGTCGGTCGTCGCGTGTGACGTGGCCGAC
CGGGACGCGGTGGCCGAGCTGGTCGCCAAGGTGCCGTCCGAACACCCCCTGACCGCGGTC
GTCCACACCGCGGGCGTCCTGGCGGACGGCACGATCGCCGCACTGGACGCGGAGCGCGTC
GACACGGTGATGCGGCCGAAGGTCGATGCCGTGCTCAACCTGCACGAGGCGACCAGGGAT
CTGGACCTCGCCGGATTCGTCCTGTTCTCCTCGGCCTCCGGTGCCCTCGGCAGTCCGGGC
CAGGGCAACTACGCGGCAGCCAACTCCTTCCTGGACGCCTTCGCCCACCACCGGAGGGTC
CAGGGCCTGCCCGCCGTCTCGCTCGCCTGGGGCCTGTGGGCCGAAGCCAGCGGCATGACC
GGGGAGTTCAAGGGCGACGACGTCGCACGGATCTCCCGCTCCGGGCTCGCCCCCCTCACC
AACGCGCAGGGCATGGCACTCCTCGACACCTCCCTCACCCTGGACGAGGCACTGCTCGTT
CCCGTCCGCCTCGACCCCGCCGGACTGCGCGCGCAAGCCGGCGCGGGCACCGTGCCGTCC
CTGCTCCGGGGTCTCGTGCGCACACCCGGTCGCCGCGTCGCCACCAGCAAGGCCGGCCGA
TCCTCCGGCCAGGAGGTATCGGCCCTGCTCCAGCGCCTCGTACAGCTCTCCCACGAGGAC
CGGACGCGCGCCCTGCTGGACCTCGTACGCAGCCACGCGGCAACCACGCTCGGCCACGCC
AAGCCCGACGCCGTGGAAGCCGAACGGGGCTTCCTCGACCTGGGCTTCGACTCCCTGACC
GCGGTGGAACTGCGCAACCGCCTCAACACGGCCGTCGGTCTGCGCCTCCCCGCCACCCTC
ATCTTCGACCATCCGACCCCCGCCGCCCTCGCCCACCACCTGCGCACGGAACTCGTTCCC
GACGAGGGCGAGGCAACCGGCGACGCCCCTCGCTTCACCTCGGACAGCGGAGCGGGCGAC
GAAGGCCGGAGTGCCGAGGAGACGACCCTCGCCGTCGACGACATGGACATCGCCGACCTG
ATCCGCATGGCACACGGCGAACTCGGCACCACCGAACAGCAACAGGCCGATGCATCAACA
CAGTTCGAAGCGCCCGGGCACAACGGCGGGCCGGGACGATCCGAAGGGCAGAGCTCGTGA
[1] KS13..387
[1] AT568..884
[1] malonyl-CoA not conserved HAFHS758..762
[1] ACP992..1062
[2] KS1089..1455
[2] AT1617..1940
[2] malonyl-CoA1812..1816
[2] KR2256..2436
[2] ACP2550..2620
[3] KS2649..3024
[3] AT3179..3497
[3] ethylmalonyl-CoA3371..3375
[3] DH3545..3705
[3] ER4023..4326
[3] KR4336..4516
[3] ACP4625..4695
[1] KS37..1161
[1] AT1702..2652
[1] malonyl-CoA not conserved HAFHS2272..2286
[1] ACP2974..3186
[2] KS3265..4365
[2] AT4849..5820
[2] malonyl-CoA5434..5448
[2] KR6766..7308
[2] ACP7648..7860
[3] KS7945..9072
[3] AT9535..10491
[3] ethylmalonyl-CoA10111..10125
[3] DH10633..11115
[3] ER12067..12978
[3] KR13006..13548
[3] ACP13873..14085

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [562-690]  G3DSA:3.40.366.10 [758-872]  G3DSA:3.40.366.10 [1609-1742]  G3DSA:3.40.366.10 [1812-1929]  G3DSA:3.40.366.10 [3175-3302]  G3DSA:3.40.366.10 [3371-3486]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [4148-4169]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [2578-2593]  PS00012 [4653-4668]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [995-1061]  6.70000000000001e-13 PF00550 [2553-2619]  2.4e-14 PF00550 [4628-4694]  5.8e-13 PF00550
PF00550   PP-binding
 [992-1062]  PS50075 [2550-2620]  PS50075 [4625-4695]  PS50075
PS50075   ACP_DOMAIN
 [985-1105]  1.99999636034521e-22 SSF47336 [2543-2665]  9.80000272130218e-28 SSF47336 [4617-4712]  5.00000909915354e-24 SSF47336
SSF47336   ACP_like
 [993-1096]  1.70000000000001e-52 G3DSA:1.10.1200.10 [2550-2623]  5.80000000000004e-65 G3DSA:1.10.1200.10 [4623-4698]  5.80000000000004e-65 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR011032 GroES-like (Domain)
 [4011-4155]  8.79996401030972e-34 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [4159-4257]  9.10000000000001e-18 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [4042-4096]  3.9e-08 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [2256-2434]  5.30000000000001e-62 PF08659 [4336-4515]  6.60000000000002e-65 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [13-264]  5.30000000000001e-82 PF00109 [1089-1331]  3.60000000000002e-78 PF00109 [2649-2899]  3.70000000000004e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [272-387]  5.49999999999995e-33 PF02801 [1340-1455]  1.29999999999998e-39 PF02801 [2907-3024]  1.80000000000002e-45 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [568-884]  6.29999999999998e-77 PF00698 [1617-1940]  3.30000000000002e-66 PF00698 [3179-3497]  4.80000000000003e-93 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [566-856]  1.40000506907309e-59 SSF52151 [1615-1911]  2.1000026783403e-69 SSF52151 [3177-3480]  4.60000044330862e-63 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [692-757]  5.79999653854781e-15 SSF55048 [1744-1811]  5.69999708783953e-18 SSF55048 [3305-3370]  4.00000300869883e-13 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [13-275]  G3DSA:3.40.47.10 [276-459]  G3DSA:3.40.47.10 [1097-1342]  G3DSA:3.40.47.10 [1344-1509]  G3DSA:3.40.47.10 [2651-2911]  G3DSA:3.40.47.10 [2912-3077]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [5-386]  7.40000780398351e-86 SSF53901 [1081-1454]  2.80000504261099e-91 SSF53901 [2641-3023]  5.29997329885557e-102 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2256-2434]  1.39999999999997e-65 G3DSA:3.40.50.720 [4156-4250]  2.4e-21 G3DSA:3.40.50.720 [4336-4550]  1.39999999999997e-65 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [177-193]  PS00606 [1245-1261]  PS00606 [2812-2828]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020615 Thiolase, acyl-enzyme intermediate active site (Active_site)
 [182-200]  PS00098
PS00098   THIOLASE_1
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [570-866]  1.09999184471405e-94 SM00827 [1618-1920]  5.29997329885557e-126 SM00827 [3181-3479]  4.89996723796399e-104 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [993-1065]  2.39999798157265e-21 SM00823 [2551-2623]  2.39999798157265e-36 SM00823 [4626-4698]  6.10002656149838e-35 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [3545-3705]  1e-85 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [15-459]  SM00825 [1091-1509]  SM00825 [2651-3077]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2256-2436]  4.19999771339582e-51 SM00822 [4336-4516]  2.50000909916183e-64 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [4023-4326]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit