close all open/close all

CDS information : Indano_00180


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction44,903 / 60,547 / + [in whole cluster]
44,903 / 60,547 / + [in contig]
Location44903..60547 [in whole cluster]
44903..60547 [in contig]
TypeCDS
Length15,645 bp (5,214 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
Gene
Gene (GenBank)idmN
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)

close this sectionPKS/NRPS Module

6 malonyl-CoA
7 ethylmalonyl-CoA
8 methylmalonyl-CoA
KS34..410
AT569..877
DH923..1093
KR1481..1661
ACP1769..1839
KS1866..2240
AT2396..2714
DH2762..2922
KR3216..3398
ACP3505..3575
KS3598..3974
AT4128..4448
KR4772..4954
ACP5059..5129

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MASDEKLVEYLKWVTADLHETRERLQELESGSREPIAIIGMSCRYPGDVRSPEELWELVR
TGTDAVSDFPGNRGWDVEGLYDPDPERRGKLYAREGGFLHDADRFDAGFFGISPREATAI
DPQQRLLLETSWEAFERAGIAPDSLRGTRTGVFTGVMYDDYGVRMRPMPEAFEGLLGSGS
AGSVASGRVAYTFGLEGPAVTVDTACSSSLVAMHLASQALRDGECSLALAGGVALMATPT
IFIEFSRQRGLARDGRCKPFSDAADGTGWGEGVGVLLLERLSDARRNGHRILAVLRGSAV
NQDGASNGLTAPNGPSQQRVIETALANAQLSTNDVDAVEAHGTGTSLGDPIEAQALLATY
GQGRPEERPLWLGSVKSNIAHTQAAAGVAGVIKMVMALRHGVLPKTLHVDAPSAHVDWAA
GAVELLTESRDWPRTDGRPRRAGVSSFGISGTNAHVIVEEAPESSADAVAESGVRVPVPV
VPWVVSARGADGLAAQAERLAGFVEERAELDPVDVGFSLAASRAVLERRAVVMGQDRDGL
RDALRALAEGSPSAGVVSGVARGRARVAFGFSGQGAQRVGMGAELASVYPVFAEALAEVS
GALGLDPEVFGDVDRLGRTEVTQAALFAFEVAVVRLLESFGVRPDVLIGHSIGEIAAAYV
AGVFSLEDAARLVGARGRLMQALPAGGVMVAVQAGEAEVVAALEGFADRVSVAAVNGPSS
VVVSGEAEAVEEVVARLREVKSRRLRVSHAFHSPLMEPMLADFRQVAEQITYNEPQLPLI
SNVSGRIAGQGELTTPDYWVRHVREAVRFGDGVGALAADGVGVLVEVGPDSVLTALARES
LDGEDGLRAVPLLRKDRPEPETLLTGVAQAFTHGVQVDWPALLPGGRRVELPTYAFQQQS
YWLEEPSRSAGDPAAFGLGAADHPLLTAAVGLADGQGVVLTGRLSLRTHPWLADHAVAGT
VLLPGTAFVELAIRAGDEVGCGRLEELALEAPLLMTEDDALAVQVRVGAPDEAGRRPVGV
YSRSGNSGDEQEWAQHASGVLTADTPGEALDRTEGALDLTVWPPADTEPIDLSGFYEASA
TSGYGYGPAFQGLRAAWRRGDEIFAEVSLPEHAEQAEQGERPEQGELPGRSGQTDQDERA
SGFGMHPALLDAVLHAVIAAESQGARPRDPEPQGDVRLPFSWNGVSLHAAGATTVRARIR
LSGTDSVSLQVADGTGRPVMSVDALVSRPVPAEQLRHPASGDASGLFDVEWVPVPAVPRT
PEPERTWAVLGRDGRGLDELAQDADTYPAFVVFPCVTTVTATATDDLTATDDLATATDDL
TATDDLAAATDDSTVIDGLAVAARAATVQALELVRRWLSDERYADSQLVVVTSGAVATSS
DAPVADLVHAPVWGLVRSAQAEHPGRFVLVDVDADGDGDGDGDGDVDPASDGREGWEAVL
PAALAAGEAQLAVRDGRILSPRLVRTPVTQETSTSPWDTEGTVLITGGTGSLGREVARHL
VVTHGVRHLVLAGRRGMEAPGARESAAELSGLGASVSVVACDVADRDAVDGLLSQLSAER
PLRAVIHTAGVLDDGTVTGLTPERLEAVMRPKVDAAVNLHLATRELDLDAFVLFSSAAGV
FGNPGQANYAAANTFLDALAAHRRTRGLPAVSLAWGLWDENGGMAAGLQDGDRARLTRTG
AQALSNEQGLALFDAATAAGQRALLVPIRLEMGVLRAQAGSGTLSPLLRGLVRTPARRTA
AARAQSGNRSSDFGRRLAGLAEPEQEGLLLDLVCAHVAAVLGHVSSGGIDAEQAFRSLGF
DSLMAVELRNRLNDATGLRLPASLVFDHPTPVVLARHLRAELAGTRDVADGTRTADTRAN
AGSADEPLAIIGMACRYPGGVQTPEDLWQMVLEGRDATTPLPDDRGWDPAAIYDPDPDAV
GKNYAVAGGFLQDAAGFDADLFGISPREALTMDPQQRLLLETSWEVFERAGIAPESLSGS
QVGVFAGAMGSDYMATLKVPDELEGYSATGSAGSVLSGRIAYTFGLEGPAVTVDTACSSS
LVAMHLAGQALRGGECSMALAGGVQVIATPKGFIEFSRQRALAPDGRSKAFSAAADGTGW
GEGVGMLLLERLSDARRNGHRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRAALANAG
LTPNDIDAVEAHGTGTPLGDPIEAQALQATYGRDRTTDDPLWLGSIKSNIAHTQAAAGVA
GVIKMVMALRNGVLPKTLHADEPSPHVDWSAGAVELLTESRDWPRTDGRPRRAGVSSFGI
SGTNAHVIVEQAPESSVEAVGERVPVGVVPWVVSARSAEGLAGQAERLARFVEERAELDL
TDVGFSLAGSRSVLEHRAVVLGQDRDGLLDGLRALAEDSPSAGVVSGVGDVRGRVVFVFP
GQGSQWVGMAVELLESSVVFGEVFAECDRVLGALTGWSVVDVVRGVVGAPSLERIEVLQP
VLFAVQVSLARLWGSVGVVPAAVVGHSQGEVAAAYVAGALSLEDAARVVVRRSDLFAREL
VGRGAVASVALGAVEVEERLAGWGGRLSVAGRNGPAAVTVAGEVAALEEFVASCRGEGVR
ARVLGSTVASHSVQVDALRGRIVELFADIVPRASRVPMYSTVTGRVIDTVGLDAGYWFDN
ARRPVDYEGAVRALVADGFRFFVESSAHPVLTVGTQATCEDVGVEVVAVGSLRRGEGGLG
RFVASVAEAFTRGLVVDWAGLLAGGRRVELPTYAFQRRRFWLEDAGVAGGDAGVWGLAAA
EHPLLGAAVHLADEQGVVLTGRVSLRTHPWLVDHAVAGTVLLPGTAFVELAIRAGDEAGC
GRLDELTLEAPLVVPEDRSVSIQVRVGPATDTGSRPVTVHSRTADDQDWVHHAGGQLTPD
DTAEAFDLAVWPPADAEPLPLEGFYEGLTESGYGYGPVFQGLRAAWRRGEELFAEVALPA
EEAEAAAGFGIHPALLDAALHAGLVGQEPDGQVRLPFMWSGVTLFAQGASSVRVRLLPTG
EDSVSVQVADVEGTPVASADALVTRPVATDRLRQSGDPDHGVLFGLDWLPAAETQASADA
HWAVLGGEELAGAEPYPEYVVLPCTPVRCGDLADVVHDVTGEVLTAIQDWLSDPAATRSR
LVVVTRGAVGVGTDDVSDLSHAAAWGLVRSAQTENPDRFVLVDVDDATDWEPVLSSVLAV
GETQMAVRGGTVLTPRLTATEAVRPEAGEAAWDPDGTVLVTGGTGLLGRVLARHLVAERG
VRHLLLTSRRGAGAPGADELSAELSAAGANVTIAACDMADRDAVDALLTDIPEEHPLTAV
VHSAGVLDDGTVTGLTSERLTAVLRPKVDAAVTLHQATQDLNIDLRAFVLFSSAAGVFGN
PGQGNYAAANTFLDALAQHRRAQGLPAVSLAWGLWDEDGGMSEHLADADRARFSRTGASA
LSNEQGLALFDSAVAAGERALLVPIRVDLATLRAQAGSGALPPLLRGLVRLPARRAAAGG
PAGVPASALSQRLAPLGEQEQERLLLDLVRDVAVAVLGHAKTDAVDPRRGFLEQGFDSLT
AVQLRNRLNTATGLRLPSTLVFDHPTPLALARHLRTEVVGGRRTAGETRGTAAAAADEPL
AIIGMACRFPGGVESPEDLWRLVSEGRDAVSALPGDRGWDLETLYDPDPAVPGKSYVREG
AFVYDAGAFDAELFGISPREALAMDPQQRLLLEATWEVFERAGLPAESLRGSQVGVFAGA
MGSDYLPGPDRMPPGVEGYAMTGSTGSVVSGRISYAFGLEGPAVTVDTACSSSLVALHLA
GQALRGGECSLALAGGVTVMAGPHELTEFSRQRALARDGRCKAFSAAADGFGFAEGVGLV
LLERLSDARRNGHEILAVVRGSAVNQDGASSGLTAPNGPSQQRVIRAALANARLSADDVD
AVEAHGTGTTLGDPIEAQALIATYGQDRPEDRPLWLGSVKSNIAHTQAAAGAAGLIKTVM
ALRHGVLPKTLHVDEPSPHVDWSAGAVELLTEAREWPQVGRARRAGVSSFGISGTNAHVI
VEQAPEPTVEAVGERAPVGEVPWVMSARSAAGLAGQADRLARFVGVRPELDPVDVGWSLV
GSRSVLEHRAVVLGRGRDELVAGLASLASGVSAPGVVCGVGRGGVRPVLVFPGQGSQWVG
MAVGLLESSPVFAERLGECEAALAPFVEWSLRDVLGGGVGSVGLLERVDVVQPVLFAVMV
SLAELWRSVGVVPAAVVGHSQGEIAAACVAGGLSLGDAARVVALRSRALRRLSGLGGMVS
VAAGRERTEDLLAGWVGRVGVAAVNGPGSTVVSGDADALDELVVVCEGLGVRARRVAVDY
ASHSAHVDLIREELGELLAPVVPVSSGVPFFSTVTGDWLDTARLDAGYWFENLRRPVRFG
EATRALLDEGFSVFIESSAHPVLATGISETVDAGDVPGAVVGSLRRGEGGMGRFLTSVAE
AFVRGVEVDWASVLPGGRRVDLPTYAFQRKHYWLEPLDKPRHADDGDIARNAVDSQFWEA
VESQNLDELARTLEPGANGAAAKVRSSLETVLPALASWRRQRREHSVVDSWRYRVGWRPL
RSATAGAAALSGTWLVVAPAAHREHPWVTAATDALRDGGAEVRTVVLDAAEAERVAWTQE
LSATAAPAASGVLSLLALDETPLPRHPGVAAGLGATLTLLQALGDAGIEAPLWCATQGAV
SVSSIDPGPHPLQAQVWGLGRVAGLETPQRWGGLLDLPETPDPRSAGRLCTAVADSGDED
QLALRGSGVFVRRLVRAPLDDRTTTRQWSPTGTALVTGGTGGLGAHVARWLAAQGAEHVV
LTSRRGPEAEGADELRSQLEESGARVTIAACDMADRESVSELLDRLRREGSPVRTVVHAA
GVPGRFVSLADAQLSDLAETLAAKATGAETLDELLGQDDEVDAFVLFSSNAGIWGGSGQG
AYAAANAHLDALAERRRARGAAATSVAWGMWDGDGLANEQGMGEALSLRGLRAMDPALAI
TALHQALDRDETTLSVTDMDWERFVSLFTVTRPSPFLDELPEVRELSKAPETAEEESGSR
SALERQLAGLPVAERHRALTELVQAQAATVLGHAKPDEVEPERGFLESGFGSLTAVELRN
RLNEATGLRLPASTVYDHPTPAALARHLHAQLQPGEDGGEVDALEGLQRIEAAVLAAPAD
GGVRDRVAKRLRDLLRTMDAGAESQADGGLDRTTLESASDDEMFALIDKELGLD
selected fasta
>polyketide synthase [polyketide synthase]
ATGGCCAGTGACGAGAAGCTTGTCGAGTACCTCAAGTGGGTCACGGCCGATCTGCACGAG
ACCCGCGAACGGCTGCAGGAACTCGAGTCCGGCAGCCGGGAACCCATCGCGATCATCGGC
ATGAGCTGCCGCTACCCCGGTGACGTGCGGTCCCCCGAGGAGCTGTGGGAGCTCGTGCGG
ACCGGTACCGACGCGGTGTCGGACTTCCCCGGCAACCGCGGCTGGGACGTCGAGGGGCTC
TACGACCCGGATCCCGAGCGGCGCGGAAAGCTCTACGCACGCGAGGGCGGATTCCTGCAC
GACGCGGACCGCTTCGACGCCGGCTTCTTCGGCATCAGCCCGCGCGAGGCGACCGCGATC
GACCCGCAGCAACGGCTGCTGCTGGAGACCTCCTGGGAGGCCTTCGAACGGGCCGGGATC
GCACCCGACTCCCTGCGCGGCACCCGGACCGGCGTTTTCACGGGAGTCATGTACGACGAC
TACGGCGTACGCATGCGGCCCATGCCCGAGGCCTTCGAGGGCCTCCTCGGCAGCGGCAGC
GCGGGCAGCGTGGCCTCCGGTCGGGTCGCCTACACCTTCGGCCTCGAAGGGCCCGCGGTG
ACGGTGGACACGGCGTGCTCGTCGTCCCTGGTGGCGATGCACCTCGCGAGCCAGGCACTG
CGGGACGGTGAGTGCTCGCTGGCGCTCGCGGGCGGCGTCGCGCTGATGGCCACCCCCACG
ATCTTCATCGAGTTCAGCCGTCAGCGGGGACTGGCCCGCGACGGCCGCTGCAAGCCCTTC
TCCGACGCGGCCGACGGCACCGGCTGGGGCGAAGGCGTCGGTGTCCTCCTGCTGGAGCGC
CTGTCGGACGCCCGCCGCAACGGGCATCGGATCCTCGCGGTCCTGCGGGGCAGCGCGGTG
AACCAGGACGGCGCGAGCAACGGCCTCACGGCACCCAACGGCCCGTCCCAGCAACGCGTC
ATCGAGACTGCCCTGGCCAACGCGCAGCTGTCGACGAACGACGTCGACGCCGTGGAGGCC
CATGGCACGGGCACCTCCCTCGGGGACCCGATCGAGGCGCAGGCGCTGCTGGCCACCTAT
GGCCAGGGGCGTCCGGAAGAGCGGCCGTTGTGGCTCGGCTCGGTCAAGTCGAACATCGCG
CACACGCAGGCCGCGGCGGGTGTCGCCGGCGTCATCAAGATGGTGATGGCCCTGCGGCAC
GGGGTGCTGCCGAAGACCCTGCATGTGGACGCTCCCTCGGCGCACGTGGACTGGGCTGCG
GGCGCGGTGGAGTTGCTGACCGAATCCCGGGACTGGCCGCGGACCGACGGGCGTCCGCGG
CGGGCCGGTGTGTCGTCGTTCGGGATCAGCGGGACGAACGCGCACGTGATCGTGGAAGAG
GCGCCCGAGTCCTCTGCCGACGCGGTTGCCGAGTCGGGTGTCCGTGTCCCGGTTCCGGTG
GTGCCGTGGGTGGTGTCGGCGCGCGGGGCCGACGGGCTGGCCGCCCAGGCCGAGCGGTTG
GCCGGGTTCGTGGAAGAGCGGGCCGAGCTGGACCCGGTGGATGTGGGGTTCTCGCTGGCA
GCCTCACGAGCGGTACTGGAGCGCCGGGCCGTGGTGATGGGTCAGGACCGGGATGGGCTG
CGCGACGCCCTGCGGGCCCTGGCCGAGGGCTCGCCGAGTGCGGGTGTGGTGTCCGGGGTG
GCTCGGGGACGGGCGCGGGTGGCGTTCGGGTTCTCGGGGCAGGGGGCGCAGCGGGTCGGG
ATGGGTGCCGAACTTGCTTCCGTCTATCCGGTGTTCGCGGAGGCTTTGGCGGAGGTCTCG
GGTGCCTTGGGTCTGGATCCCGAGGTGTTCGGAGATGTGGATCGGCTGGGCCGGACGGAG
GTGACGCAGGCTGCGCTCTTCGCCTTTGAGGTGGCGGTGGTGCGGTTGTTGGAGAGTTTT
GGGGTGCGGCCTGATGTGTTGATCGGGCATTCGATCGGGGAGATCGCGGCTGCGTATGTG
GCGGGGGTGTTCTCGCTGGAGGATGCGGCCCGGCTGGTGGGGGCGCGGGGTCGGTTGATG
CAGGCGTTGCCGGCTGGTGGCGTGATGGTTGCGGTGCAGGCGGGTGAGGCGGAGGTCGTT
GCCGCTCTTGAGGGTTTCGCTGATCGGGTCTCCGTGGCGGCGGTCAATGGTCCGTCGTCG
GTGGTGGTCTCCGGTGAGGCGGAGGCTGTGGAGGAAGTCGTCGCGCGGCTGAGGGAGGTC
AAGTCCCGTCGTCTGCGGGTCAGTCACGCGTTCCACTCGCCCTTGATGGAACCGATGCTG
GCTGACTTCCGGCAGGTCGCCGAGCAGATCACTTACAACGAGCCGCAGCTGCCGCTGATC
TCCAATGTGAGCGGGAGGATCGCGGGACAGGGCGAGCTGACCACGCCCGACTACTGGGTG
CGGCATGTGCGTGAGGCGGTCCGTTTCGGTGACGGTGTCGGCGCGCTGGCCGCTGACGGT
GTCGGTGTGCTGGTGGAGGTCGGTCCGGACAGCGTCCTGACCGCGCTGGCCCGGGAGTCC
CTCGACGGCGAGGACGGTCTGCGGGCGGTTCCGCTGCTGCGCAAGGACCGACCCGAGCCG
GAGACCCTGCTGACCGGGGTGGCGCAGGCGTTCACGCACGGCGTCCAGGTCGACTGGCCT
GCCCTGCTGCCCGGCGGCCGCCGTGTGGAACTGCCCACCTACGCCTTCCAGCAGCAAAGT
TACTGGCTGGAGGAACCGTCACGGTCCGCGGGCGACCCGGCCGCGTTCGGGCTGGGCGCC
GCGGATCATCCGTTGCTGACCGCCGCGGTGGGGTTGGCGGACGGACAGGGCGTGGTTCTC
ACCGGCCGTCTGTCACTGCGTACGCATCCGTGGTTGGCGGACCATGCGGTGGCCGGGACG
GTGCTGCTGCCGGGCACGGCCTTCGTGGAGCTGGCGATCCGGGCCGGGGACGAGGTGGGC
TGCGGGCGTCTGGAAGAACTCGCACTCGAAGCACCGCTTTTGATGACCGAGGACGACGCG
CTCGCCGTGCAGGTCCGGGTCGGGGCGCCCGACGAGGCCGGGCGGCGCCCTGTGGGCGTG
TACTCCCGGAGCGGGAACTCGGGCGACGAGCAGGAATGGGCGCAGCATGCCAGTGGTGTG
CTCACCGCCGACACGCCGGGGGAGGCGCTGGACAGGACGGAGGGGGCGCTCGACCTGACG
GTCTGGCCTCCGGCCGACACCGAACCCATCGACCTGAGCGGCTTCTACGAGGCATCGGCC
ACGAGCGGATACGGGTACGGTCCCGCCTTCCAGGGCCTGCGCGCGGCTTGGCGACGCGGC
GACGAGATCTTCGCCGAGGTGAGCCTGCCCGAGCACGCGGAGCAGGCGGAGCAGGGAGAG
CGGCCGGAGCAGGGAGAGCTGCCGGGGCGGTCCGGCCAGACGGACCAGGACGAGCGCGCG
AGCGGGTTCGGGATGCATCCGGCTCTGCTGGACGCGGTTCTCCACGCGGTGATCGCCGCA
GAGTCGCAGGGTGCCCGGCCGCGGGACCCCGAGCCGCAGGGTGACGTGCGACTGCCCTTC
TCCTGGAACGGAGTCTCGCTGCACGCCGCCGGCGCCACGACCGTGCGGGCCCGCATCCGG
CTCTCCGGCACGGATTCCGTCTCCCTCCAGGTGGCGGACGGCACAGGCCGGCCCGTGATG
TCGGTCGACGCGCTGGTGTCCCGCCCCGTCCCGGCCGAACAACTGCGGCATCCGGCCAGT
GGTGACGCGAGCGGCCTGTTCGACGTCGAGTGGGTCCCCGTACCCGCCGTACCCCGGACA
CCGGAGCCCGAGCGGACATGGGCGGTGCTCGGACGCGATGGCCGCGGGCTGGACGAGCTC
GCGCAGGACGCGGACACCTACCCGGCCTTCGTCGTGTTCCCCTGCGTCACAACCGTCACC
GCCACCGCTACCGACGACCTGACCGCCACCGATGACCTCGCCACCGCTACCGACGACCTG
ACCGCCACCGATGACCTCGCCGCCGCCACCGACGACTCCACCGTCATTGACGGCCTGGCC
GTGGCCGCACGTGCGGCCACGGTGCAAGCGCTGGAGCTCGTCCGCCGCTGGCTGTCCGAT
GAGCGGTACGCGGACTCGCAGCTGGTCGTCGTGACCAGCGGAGCCGTCGCCACATCGAGT
GACGCACCCGTGGCAGACCTGGTGCACGCGCCGGTCTGGGGGCTGGTGCGGTCCGCGCAG
GCCGAGCACCCCGGCCGGTTCGTCCTGGTCGACGTCGATGCCGATGGCGACGGCGATGGC
GACGGCGATGGCGACGTCGATCCGGCTTCGGACGGTCGTGAAGGCTGGGAAGCGGTCCTG
CCCGCCGCTCTGGCGGCCGGCGAAGCCCAGCTGGCGGTGCGCGACGGTCGGATCCTGAGC
CCTCGCCTGGTCAGGACTCCCGTCACACAGGAGACGTCCACGAGCCCGTGGGATACCGAG
GGCACGGTGTTGATCACCGGTGGCACGGGCTCGCTGGGGCGGGAGGTGGCCCGGCATCTG
GTGGTCACGCACGGGGTGCGGCATCTGGTGCTCGCCGGTCGTCGCGGCATGGAGGCCCCG
GGGGCCCGGGAGTCGGCGGCGGAGCTGTCGGGTCTGGGCGCGTCGGTGTCGGTGGTGGCC
TGTGACGTGGCCGACCGTGACGCGGTGGACGGGCTGCTGTCCCAGCTCTCGGCGGAGCGC
CCGTTGCGGGCGGTGATCCACACGGCGGGCGTGCTGGACGACGGTACGGTGACCGGGCTG
ACCCCCGAGCGGCTCGAAGCGGTCATGCGGCCGAAGGTGGACGCCGCGGTCAACCTCCAC
CTCGCGACGAGGGAGTTGGACCTCGACGCCTTCGTCCTGTTCTCCTCGGCCGCCGGTGTG
TTCGGCAACCCCGGGCAGGCCAACTACGCGGCTGCCAACACCTTCCTGGACGCGCTTGCC
GCGCACCGCAGGACGCGTGGTCTGCCCGCCGTGTCCCTGGCCTGGGGTCTGTGGGACGAG
AACGGCGGAATGGCCGCGGGCCTCCAGGACGGCGATCGGGCACGGCTGACCCGTACGGGC
GCGCAGGCCCTGTCGAACGAGCAGGGGCTGGCGTTGTTCGACGCCGCCACCGCTGCCGGG
CAGCGGGCGCTGCTGGTGCCGATCCGTCTGGAGATGGGTGTTCTGCGTGCCCAGGCCGGT
TCGGGGACGCTGTCGCCGCTGCTGCGCGGCTTGGTGAGGACCCCGGCGCGCCGGACAGCC
GCCGCCCGGGCCCAATCGGGCAACCGGTCGTCGGACTTCGGCCGACGACTGGCCGGCCTC
GCCGAACCGGAACAGGAAGGCCTGCTGCTGGACCTCGTGTGTGCGCACGTGGCCGCCGTC
CTCGGTCACGTCTCCTCCGGGGGCATCGACGCGGAGCAGGCGTTCCGGAGCCTGGGCTTC
GATTCCCTGATGGCGGTCGAGCTGCGCAACCGGCTCAACGACGCCACAGGGCTACGGCTG
CCCGCCTCCCTCGTCTTCGACCACCCCACCCCCGTGGTGCTGGCACGCCACCTCCGAGCG
GAACTCGCGGGCACGCGGGACGTGGCGGACGGCACCCGCACGGCAGACACCCGCGCGAAC
GCCGGCAGCGCCGACGAACCGCTGGCGATCATCGGTATGGCCTGCCGCTACCCGGGCGGT
GTGCAGACTCCGGAAGACCTCTGGCAGATGGTGCTGGAGGGACGCGACGCGACCACCCCG
CTCCCCGACGACCGCGGCTGGGACCCGGCAGCGATCTATGACCCGGACCCCGACGCCGTC
GGCAAGAACTACGCGGTCGCGGGAGGCTTCCTCCAGGACGCCGCGGGCTTCGACGCCGAC
CTGTTCGGGATCTCGCCGCGCGAGGCACTGACCATGGATCCGCAGCAGCGTCTGCTGCTG
GAGACGTCCTGGGAGGTGTTCGAGCGGGCCGGCATCGCACCCGAGTCGCTGAGCGGCAGC
CAGGTCGGTGTGTTCGCGGGCGCGATGGGCTCGGACTACATGGCCACGCTCAAGGTGCCG
GACGAGCTGGAGGGCTACTCGGCCACCGGCAGCGCGGGCAGCGTGCTCTCGGGCCGGATC
GCCTACACCTTCGGCCTCGAAGGGCCGGCGGTGACCGTCGACACGGCCTGCTCGTCCTCC
CTGGTGGCGATGCATCTCGCCGGGCAGGCCCTGCGCGGCGGCGAGTGCTCGATGGCGCTC
GCGGGCGGCGTCCAGGTCATCGCCACTCCCAAGGGCTTCATCGAGTTCAGCCGCCAGCGT
GCGCTGGCGCCCGACGGCCGGTCGAAGGCGTTCTCGGCGGCGGCCGACGGTACGGGCTGG
GGTGAGGGTGTGGGGATGCTGCTGTTGGAGCGGCTGTCGGACGCCCGGCGCAACGGGCAC
CGCGTCCTGGCCGTCGTGCGCGGCTCGGCGGTGAACCAGGACGGTGCGAGCAACGGCCTG
ACCGCGCCGAACGGTCCGTCCCAGCAGCGTGTCATCCGGGCCGCGTTGGCCAACGCCGGC
CTGACGCCGAACGACATCGACGCCGTCGAGGCGCACGGCACCGGCACCCCGCTCGGCGAC
CCCATCGAGGCGCAGGCGCTGCAAGCCACGTACGGCCGCGACCGCACCACCGACGATCCG
CTGTGGCTGGGATCCATCAAGTCCAACATCGCGCACACGCAGGCCGCGGCCGGTGTCGCC
GGTGTGATCAAGATGGTGATGGCGCTGCGCAACGGGGTGCTGCCGAAGACACTGCACGCG
GACGAGCCGTCCCCGCACGTCGACTGGTCCGCGGGTGCGGTGGAGTTGCTGACCGAATCC
CGGGACTGGCCGCGGACCGACGGGCGTCCGCGGCGGGCCGGCGTGTCGTCCTTCGGGATC
AGCGGGACGAACGCGCACGTGATCGTGGAGCAGGCGCCCGAGTCGTCCGTCGAGGCGGTG
GGTGAGCGGGTTCCGGTCGGGGTGGTGCCGTGGGTGGTGTCGGCGCGGAGCGCTGAGGGA
CTGGCCGGCCAGGCGGAGCGGCTCGCTCGGTTCGTGGAGGAGCGGGCCGAGCTGGACCTG
ACCGATGTCGGGTTCTCACTGGCCGGGTCGCGGTCGGTGCTGGAGCACCGGGCGGTGGTC
CTGGGACAGGACCGCGACGGCCTGCTCGACGGGCTGCGCGCCCTGGCCGAGGACTCGCCG
AGTGCGGGTGTGGTGTCGGGTGTGGGTGATGTGCGGGGTCGGGTGGTGTTTGTTTTCCCT
GGTCAGGGGTCGCAGTGGGTGGGTATGGCGGTGGAGTTGCTGGAGTCGTCGGTGGTGTTC
GGGGAGGTGTTCGCCGAGTGTGACCGGGTGTTGGGGGCTTTGACGGGGTGGTCGGTGGTG
GATGTGGTGCGGGGGGTGGTGGGTGCGCCGTCGCTGGAGCGGATCGAGGTGTTGCAGCCG
GTGTTGTTCGCGGTGCAGGTGTCGTTGGCGCGGTTGTGGGGGTCGGTGGGGGTGGTGCCG
GCTGCGGTGGTGGGTCATTCGCAGGGTGAGGTGGCGGCGGCGTATGTGGCGGGTGCTTTG
TCGTTGGAGGATGCGGCGCGGGTGGTGGTGCGGCGTAGTGATCTGTTCGCGCGGGAGTTG
GTGGGTCGGGGTGCGGTGGCGTCGGTGGCGTTGGGTGCGGTTGAGGTGGAGGAGCGGCTT
GCGGGCTGGGGTGGGCGGTTGAGTGTGGCGGGGCGTAATGGTCCGGCTGCGGTGACGGTT
GCGGGTGAGGTGGCGGCGTTGGAGGAGTTCGTGGCTTCGTGCCGGGGGGAGGGGGTGCGG
GCGCGGGTGCTGGGTTCGACGGTGGCGTCGCATTCGGTGCAGGTGGATGCGTTGCGTGGG
CGGATTGTGGAGTTGTTCGCGGATATTGTTCCGCGGGCTTCGCGGGTGCCGATGTATTCG
ACGGTGACGGGGCGGGTGATCGACACCGTTGGGCTGGATGCGGGGTATTGGTTCGACAAT
GCGCGCCGGCCGGTGGATTACGAGGGTGCGGTGCGGGCGCTGGTGGCTGATGGTTTTCGT
TTCTTCGTGGAGTCGAGTGCGCATCCGGTGTTGACGGTGGGTACGCAGGCGACGTGTGAG
GACGTGGGTGTCGAGGTGGTGGCGGTGGGGTCGCTGCGTCGGGGTGAGGGGGGTTTGGGC
CGGTTCGTGGCGTCGGTGGCGGAGGCGTTCACGCGGGGTCTGGTGGTGGACTGGGCGGGG
TTGCTGGCGGGTGGTCGGCGGGTGGAGTTGCCGACGTATGCCTTTCAGCGGCGGCGTTTT
TGGCTGGAGGACGCTGGGGTGGCGGGTGGTGATGCGGGTGTGTGGGGGCTTGCGGCGGCT
GAGCATCCGTTGCTGGGTGCGGCGGTGCATCTGGCGGATGAGCAGGGTGTGGTGCTGACG
GGTCGGGTGTCGTTGCGGACGCATCCGTGGCTGGTGGATCACGCGGTGGCGGGGACGGTG
CTGCTGCCGGGTACGGCGTTCGTGGAGCTGGCGATCCGGGCCGGTGACGAGGCCGGCTGC
GGACGCCTCGACGAACTCACCCTCGAAGCACCGCTCGTCGTGCCCGAAGACCGTTCGGTC
TCGATCCAGGTGCGGGTCGGTCCTGCCACGGACACCGGCAGCCGCCCCGTGACGGTCCAC
TCCCGTACGGCTGACGATCAGGACTGGGTCCACCATGCCGGAGGACAACTCACCCCGGAC
GACACGGCGGAGGCGTTCGACCTCGCGGTGTGGCCCCCGGCCGACGCCGAGCCGCTTCCG
CTGGAGGGCTTCTACGAGGGCCTGACCGAGTCCGGCTACGGCTACGGGCCGGTGTTCCAG
GGCCTGCGGGCGGCCTGGCGACGCGGCGAGGAACTCTTCGCCGAGGTCGCTCTGCCCGCG
GAGGAGGCCGAGGCGGCGGCAGGGTTCGGAATCCATCCGGCGCTGCTGGACGCGGCCTTG
CACGCGGGGCTCGTGGGACAGGAGCCGGACGGGCAGGTACGCCTGCCGTTCATGTGGAGC
GGGGTGACGCTGTTCGCCCAGGGCGCCTCCAGCGTGCGCGTGCGGCTGCTGCCCACGGGC
GAGGACTCCGTCTCCGTACAGGTCGCCGACGTCGAAGGCACTCCGGTCGCGTCCGCCGAC
GCCCTGGTCACCCGGCCGGTCGCCACCGACCGGCTTCGGCAGTCCGGGGACCCTGACCAC
GGAGTCCTGTTCGGCCTCGACTGGCTCCCCGCCGCCGAGACACAGGCCTCGGCCGACGCA
CACTGGGCGGTGCTGGGAGGCGAGGAACTCGCGGGCGCCGAGCCCTACCCCGAGTACGTG
GTGCTGCCCTGCACCCCGGTGAGGTGCGGGGATCTCGCGGACGTGGTCCATGACGTCACC
GGTGAGGTGCTCACCGCGATCCAGGACTGGCTGTCCGACCCGGCCGCCACGCGGTCCCGG
CTCGTCGTCGTCACCCGCGGAGCCGTCGGGGTGGGCACCGACGACGTGTCGGATCTGTCC
CATGCCGCGGCCTGGGGCCTGGTCAGGTCGGCGCAGACGGAGAACCCGGACCGGTTCGTC
CTGGTCGACGTCGACGACGCGACCGACTGGGAACCGGTCCTGAGCTCCGTACTGGCCGTC
GGCGAAACCCAGATGGCGGTACGTGGCGGCACCGTACTGACACCGCGCCTGACCGCCACC
GAAGCCGTGCGCCCCGAAGCCGGCGAAGCCGCCTGGGACCCTGACGGCACCGTCCTCGTC
ACCGGCGGGACCGGCCTGCTCGGCCGGGTCCTCGCCCGCCATCTGGTCGCGGAACGAGGA
GTACGTCACCTGCTGCTGACCAGCAGGCGGGGCGCCGGAGCGCCGGGGGCCGACGAACTG
AGCGCCGAACTGTCGGCCGCGGGCGCGAACGTGACCATCGCCGCCTGCGACATGGCCGAC
CGTGACGCGGTCGACGCGCTCCTGACCGACATTCCGGAGGAGCACCCGCTGACGGCGGTC
GTCCACTCGGCCGGCGTGCTGGACGACGGAACCGTCACCGGCCTGACCTCCGAGCGGCTG
ACGGCGGTACTGCGGCCGAAGGTGGACGCCGCGGTCACCCTGCACCAGGCGACCCAGGAC
CTGAACATCGATCTGCGGGCCTTCGTCCTGTTCTCGTCGGCCGCCGGTGTGTTCGGCAAC
CCCGGGCAGGGCAACTACGCGGCCGCCAACACCTTCCTGGACGCGCTCGCCCAGCACCGC
AGGGCGCAGGGTCTGCCCGCCGTTTCCCTGGCCTGGGGGCTGTGGGACGAGGACGGCGGC
ATGAGCGAGCACCTGGCCGATGCCGACCGGGCACGATTCTCCCGCACAGGCGCCTCGGCC
CTGTCGAACGAGCAGGGGCTGGCCCTGTTCGACTCCGCCGTCGCCGCGGGGGAGCGGGCA
CTTCTGGTGCCGATCCGCGTCGACCTGGCCACCCTCCGCGCCCAGGCCGGCTCGGGTGCG
CTTCCGCCGTTGCTGCGCGGTCTCGTACGCCTCCCCGCCCGGCGCGCCGCGGCCGGCGGA
CCGGCCGGCGTACCGGCATCGGCGCTGTCCCAGCGCCTGGCCCCCCTGGGAGAACAGGAA
CAGGAACGTCTCCTGCTGGACCTCGTCCGCGATGTCGCCGTGGCCGTGCTGGGGCATGCG
AAGACGGACGCCGTGGATCCACGGCGGGGCTTCCTGGAGCAGGGCTTCGACTCGCTGACC
GCGGTCCAGCTGCGGAACCGGCTCAACACCGCCACGGGACTGCGACTGCCCTCGACCCTG
GTCTTCGACCACCCGACCCCCCTGGCGCTCGCCCGCCATCTGCGGACCGAGGTGGTCGGC
GGCAGGCGGACGGCGGGGGAGACCCGCGGGACGGCGGCCGCCGCGGCCGACGAACCGCTG
GCGATCATCGGCATGGCCTGCCGGTTCCCCGGCGGTGTCGAGTCCCCCGAGGACCTGTGG
CGCCTGGTCAGCGAGGGCCGTGACGCGGTCTCGGCACTGCCCGGTGACCGCGGCTGGGAC
CTGGAGACGTTGTACGACCCGGACCCGGCCGTACCGGGCAAGAGCTACGTGCGCGAGGGT
GCGTTCGTCTACGACGCCGGCGCGTTCGACGCGGAGCTGTTCGGGATCTCGCCGCGTGAG
GCGCTGGCGATGGATCCGCAGCAGCGCCTGCTGCTGGAGGCGACCTGGGAGGTGTTCGAG
CGGGCCGGTCTCCCGGCCGAGTCGCTGCGCGGCAGCCAGGTCGGCGTGTTCGCGGGCGCC
ATGGGCTCGGACTACCTGCCCGGCCCGGACCGGATGCCGCCAGGCGTCGAGGGTTACGCC
ATGACCGGCAGCACCGGCAGTGTCGTCTCCGGCCGGATCTCCTACGCGTTCGGTCTGGAG
GGCCCCGCCGTCACGGTGGACACGGCGTGCTCGTCCTCCCTGGTGGCACTGCACCTGGCC
GGTCAGGCCCTGCGCGGCGGCGAGTGCTCGCTCGCCCTCGCGGGCGGCGTGACCGTGATG
GCAGGACCCCACGAACTCACCGAGTTCAGCCGACAGCGCGCCCTCGCACGCGACGGACGG
TGCAAGGCGTTCTCCGCCGCGGCGGACGGCTTCGGCTTCGCGGAGGGCGTCGGCCTGGTG
CTGCTGGAGCGCCTGTCGGACGCCCGGCGCAACGGCCACGAGATCCTCGCCGTCGTACGC
GGCAGCGCCGTGAACCAGGACGGCGCCAGCAGCGGCCTGACGGCGCCGAACGGTCCGTCC
CAGCAGCGCGTGATCCGGGCCGCGCTGGCGAACGCCCGCCTGTCGGCCGACGACGTCGAC
GCGGTCGAGGCCCACGGCACCGGTACGACACTCGGAGACCCGATCGAGGCCCAGGCGCTG
ATCGCCACCTATGGCCAGGACCGGCCCGAGGACCGGCCGCTGTGGCTGGGCTCGGTGAAG
TCCAACATCGCGCACACCCAGGCCGCGGCCGGAGCAGCGGGACTGATCAAGACCGTGATG
GCGTTGCGGCACGGCGTGCTGCCCAAGACGCTGCACGTCGATGAGCCGTCGCCGCATGTG
GACTGGTCGGCGGGTGCGGTGGAGCTGCTGACCGAGGCGCGCGAGTGGCCGCAGGTGGGG
CGTGCGCGCCGCGCCGGTGTGTCGTCGTTCGGGATCAGTGGGACGAACGCGCACGTGATC
GTGGAGCAGGCGCCCGAGCCCACCGTCGAGGCGGTGGGTGAGCGGGCCCCGGTCGGGGAG
GTGCCGTGGGTGATGTCGGCGCGGAGCGCGGCGGGATTGGCCGGCCAGGCGGATCGGCTC
GCCCGGTTCGTCGGTGTGCGGCCGGAGCTGGATCCGGTGGATGTGGGGTGGTCGTTGGTT
GGTTCGCGGTCGGTGCTGGAGCACCGGGCGGTGGTGCTGGGCAGGGGCCGGGACGAGTTG
GTGGCCGGTCTTGCCTCGCTTGCCTCGGGAGTGTCCGCGCCGGGTGTGGTGTGTGGGGTG
GGTCGGGGTGGTGTGCGGCCGGTGTTGGTGTTTCCGGGGCAGGGGTCGCAGTGGGTGGGG
ATGGCGGTGGGGTTGTTGGAGTCGTCGCCGGTGTTTGCGGAGCGGTTGGGGGAGTGTGAG
GCGGCGTTGGCTCCGTTTGTGGAGTGGTCGTTGCGGGATGTGTTGGGGGGTGGTGTGGGG
TCGGTGGGGTTGTTGGAGCGGGTTGATGTGGTGCAGCCGGTGTTGTTTGCGGTGATGGTG
TCGTTGGCGGAGTTGTGGCGGTCGGTGGGGGTGGTGCCGGCTGCGGTGGTGGGGCATTCG
CAGGGGGAGATTGCTGCTGCGTGTGTGGCGGGTGGTTTGTCGTTGGGTGATGCGGCGCGG
GTGGTGGCGTTGCGGAGTCGGGCGTTGCGGCGGTTGTCGGGGTTGGGTGGGATGGTGTCG
GTGGCGGCGGGGCGGGAGCGGACGGAGGATCTGCTGGCCGGGTGGGTGGGTCGTGTGGGT
GTTGCGGCGGTGAATGGTCCGGGGTCGACGGTGGTGTCGGGTGATGCGGATGCGTTGGAT
GAGTTGGTGGTGGTGTGTGAGGGGTTGGGGGTGCGGGCGCGTCGGGTTGCGGTGGATTAT
GCGTCGCATTCGGCTCATGTGGATTTGATTCGGGAGGAGTTGGGGGAGTTGTTGGCGCCG
GTTGTTCCGGTGTCTTCGGGGGTGCCGTTCTTTTCGACGGTGACGGGTGACTGGCTCGAC
ACGGCGCGGTTGGACGCGGGGTATTGGTTTGAGAATCTTCGTCGGCCGGTGCGGTTCGGG
GAGGCGACGCGTGCGTTGCTGGATGAGGGTTTCTCGGTGTTCATCGAGTCGAGTGCGCAT
CCGGTGCTGGCGACGGGGATCTCGGAGACGGTGGATGCGGGGGATGTGCCGGGTGCGGTG
GTGGGTTCGCTGCGTCGGGGTGAGGGGGGTATGGGGCGTTTCCTGACCTCGGTGGCGGAG
GCGTTCGTCAGGGGTGTGGAGGTGGACTGGGCGAGTGTGCTGCCCGGGGGTCGTCGGGTG
GATCTGCCGACCTACGCCTTCCAGCGCAAGCACTACTGGCTCGAACCCCTCGACAAGCCG
CGGCACGCCGACGACGGCGACATCGCGCGGAACGCCGTCGACTCGCAGTTCTGGGAGGCG
GTCGAGAGCCAGAATCTGGACGAACTCGCCCGCACTCTCGAACCCGGTGCCAACGGTGCC
GCCGCAAAGGTGCGTTCGTCGCTGGAGACGGTGCTTCCGGCCCTGGCCTCCTGGCGCAGG
CAACGCCGGGAACACTCGGTCGTCGACTCCTGGCGCTACCGCGTCGGTTGGCGTCCCCTG
CGGTCGGCCACGGCCGGTGCCGCCGCGCTGTCGGGGACGTGGCTGGTAGTCGCTCCCGCC
GCGCACCGGGAGCACCCGTGGGTGACGGCGGCGACCGACGCGCTGCGCGACGGCGGCGCC
GAGGTCCGGACGGTCGTACTGGACGCGGCGGAGGCCGAACGCGTGGCGTGGACACAAGAA
TTGAGTGCGACAGCCGCTCCGGCGGCGAGCGGCGTCCTGTCGCTGCTGGCCCTGGACGAG
ACGCCGTTGCCCCGGCATCCCGGTGTCGCAGCCGGGCTCGGCGCGACCCTCACACTGCTC
CAGGCGCTGGGCGACGCCGGCATCGAGGCACCCCTGTGGTGCGCCACCCAGGGCGCCGTC
TCCGTCAGCAGCATCGACCCGGGACCGCATCCGCTCCAGGCGCAGGTCTGGGGGCTCGGA
CGCGTGGCCGGGCTCGAGACGCCCCAGCGCTGGGGCGGACTCCTCGACCTGCCCGAGACC
CCCGACCCCAGGTCCGCGGGCCGGCTGTGCACCGCTGTGGCCGACTCGGGCGACGAGGAC
CAGCTCGCCCTGCGCGGCTCGGGCGTGTTCGTACGACGCCTGGTGCGCGCACCCCTGGAC
GACCGTACGACGACACGGCAGTGGAGCCCGACCGGCACCGCACTGGTCACGGGGGGTACC
GGCGGCCTCGGTGCGCATGTCGCGCGCTGGCTGGCCGCACAGGGCGCCGAACACGTCGTA
CTGACCAGCAGGCGCGGCCCCGAGGCCGAAGGCGCGGACGAACTGCGCTCGCAGCTCGAG
GAGTCGGGTGCCAGGGTGACCATCGCGGCGTGCGACATGGCGGACCGTGAGAGCGTGTCC
GAGCTGCTGGACCGGCTCAGGCGCGAGGGCTCTCCGGTACGGACGGTCGTGCACGCCGCC
GGCGTCCCCGGCCGGTTCGTCAGCCTCGCCGACGCACAACTCTCCGACCTCGCAGAGACG
TTGGCCGCCAAGGCGACCGGGGCCGAGACCCTCGACGAACTGCTCGGACAGGACGACGAG
GTGGACGCCTTCGTGCTCTTCTCGTCGAACGCCGGCATCTGGGGCGGCAGCGGGCAGGGC
GCGTACGCCGCCGCCAACGCCCACCTGGACGCGCTGGCCGAACGGCGCCGAGCTCGCGGC
GCCGCCGCCACCTCCGTCGCCTGGGGCATGTGGGACGGCGACGGTCTGGCCAACGAACAG
GGCATGGGGGAGGCGCTGAGCCTGCGCGGGCTGCGGGCCATGGACCCGGCACTGGCGATC
ACGGCACTGCACCAGGCCCTCGACCGCGACGAGACCACCCTCTCCGTCACCGACATGGAC
TGGGAGCGCTTCGTGTCCCTGTTCACGGTCACCCGTCCCAGCCCGTTCCTGGACGAATTG
CCTGAGGTCCGGGAGCTGTCGAAGGCCCCTGAGACGGCGGAGGAGGAATCCGGGTCACGG
TCGGCCCTCGAACGGCAACTGGCCGGCCTGCCCGTCGCCGAACGGCACCGCGCGCTGACG
GAGCTGGTCCAGGCACAGGCCGCCACCGTCCTCGGCCACGCGAAGCCCGACGAGGTCGAA
CCGGAGCGCGGATTCCTCGAATCGGGGTTCGGCTCCCTCACTGCGGTGGAACTGCGCAAC
CGGCTCAACGAGGCGACCGGGCTGCGCCTGCCCGCGTCCACGGTCTACGACCACCCCACG
CCCGCGGCCCTCGCCCGGCATCTGCACGCACAGCTCCAGCCGGGAGAGGACGGCGGCGAA
GTGGACGCCCTCGAAGGCCTCCAGCGGATCGAAGCGGCCGTGCTGGCGGCACCGGCGGAC
GGCGGTGTACGCGACCGCGTAGCCAAACGGCTGCGGGACCTGCTCAGGACGATGGACGCC
GGCGCCGAGTCGCAGGCCGACGGCGGCTTGGACCGGACGACCCTCGAGTCGGCATCCGAC
GACGAAATGTTCGCGCTGATCGACAAGGAACTCGGGCTCGACTGA
[6] KS34..410
[6] AT569..877
[6] malonyl-CoA749..753
[6] DH923..1093
[6] KR1481..1661
[6] ACP1769..1839
[7] KS1866..2240
[7] AT2396..2714
[7] ethylmalonyl-CoA2588..2592
[7] DH2762..2922
[7] KR3216..3398
[7] ACP3505..3575
[8] KS3598..3974
[8] AT4128..4448
[8] methylmalonyl-CoA4320..4324
[8] KR4772..4954
[8] ACP5059..5129
[6] KS100..1230
[6] AT1705..2631
[6] malonyl-CoA2245..2259
[6] DH2767..3279
[6] KR4441..4983
[6] ACP5305..5517
[7] KS5596..6720
[7] AT7186..8142
[7] ethylmalonyl-CoA7762..7776
[7] DH8284..8766
[7] KR9646..10194
[7] ACP10513..10725
[8] KS10792..11922
[8] AT12382..13344
[8] methylmalonyl-CoA12958..12972
[8] KR14314..14862
[8] ACP15175..15387

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [560-683]  G3DSA:3.40.366.10 [749-865]  G3DSA:3.40.366.10 [2392-2519]  G3DSA:3.40.366.10 [2588-2703]  G3DSA:3.40.366.10 [4126-4252]  G3DSA:3.40.366.10 [4320-4437]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1797-1812]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1769-1839]  PS50075 [3505-3575]  PS50075 [5059-5129]  PS50075
PS50075   ACP_DOMAIN
 [1772-1838]  3.4e-13 PF00550 [3508-3574]  9.9e-12 PF00550 [5063-5128]  4.40000000000001e-13 PF00550
PF00550   PP-binding
 [1769-1844]  8.39999999999977e-67 G3DSA:1.10.1200.10 [3505-3578]  8.39999999999977e-67 G3DSA:1.10.1200.10 [5057-5133]  8.39999999999977e-67 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1762-1882]  1.20000117458134e-27 SSF47336 [3498-3614]  1.89999859865865e-26 SSF47336 [5050-5136]  4.90001027782405e-23 SSF47336
SSF47336   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1481-1660]  1.20000000000001e-66 PF08659 [3216-3397]  4.10000000000004e-64 PF08659 [4772-4953]  2.1e-58 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-284]  1.10000000000001e-96 PF00109 [1866-2115]  2.20000000000002e-95 PF00109 [3598-3848]  9.00000000000011e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-410]  1.5e-47 PF02801 [2123-2240]  6.29999999999998e-49 PF02801 [3856-3974]  3.5e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [569-877]  3.99999999999998e-63 PF00698 [2396-2714]  1.5e-91 PF00698 [4128-4448]  2.50000000000001e-100 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  6.1e-14 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [566-843]  2.59998233910302e-69 SSF52151 [2394-2697]  2.1000026783403e-62 SSF52151 [4126-4431]  3.89999861795218e-65 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [685-748]  4.00000300869883e-16 SSF55048 [2522-2587]  4.00000300869883e-13 SSF55048 [4254-4319]  2.39999798157265e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [33-294]  G3DSA:3.40.47.10 [296-464]  G3DSA:3.40.47.10 [1869-2127]  G3DSA:3.40.47.10 [2128-2294]  G3DSA:3.40.47.10 [3597-3859]  G3DSA:3.40.47.10 [3860-4026]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-408]  4.30000170645869e-106 SSF53901 [1858-2239]  1.50000965748778e-102 SSF53901 [3590-4026]  9.09992432541739e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1481-1667]  5.69999999999998e-121 G3DSA:3.40.50.720 [3216-3404]  5.69999999999998e-121 G3DSA:3.40.50.720 [4772-4985]  8.49999999999995e-116 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606 [2028-2044]  PS00606 [3761-3777]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [571-857]  9.90001804798383e-121 SM00827 [2398-2696]  4.30000170645869e-103 SM00827 [4130-4428]  2.1000026783403e-119 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1770-1842]  3.70001063537244e-36 SM00823 [3506-3578]  5.40001756046195e-34 SM00823 [5060-5132]  7.60000011115808e-34 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [923-1093]  4.60000044330866e-83 SM00826 [2762-2922]  1.3000049540733e-86 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-463]  SM00825 [1868-2294]  SM00825 [3600-4026]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1481-1661]  4.89996723796399e-67 SM00822 [3216-3398]  2.80000504261099e-62 SM00822 [4772-4954]  5.00000909915354e-48 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit