close all open/close all

CDS information : Indano_00200


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction67,125 / 74,768 / + [in whole cluster]
67,125 / 74,768 / + [in contig]
Location67125..74768 [in whole cluster]
67125..74768 [in contig]
TypeCDS
Length7,644 bp (2,547 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
Gene
Gene (GenBank)idmP
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)
Related Reference
ACC
B6ZK72
NITE
Lasal_00210
PmId
[18710235] Epoxide hydrolase Lsd19 for polyether formation in the biosynthesis of lasalocid A: direct experimental evidence on polyene-polyepoxide hypothesis in polyether biosynthesis. (J Am Chem Soc. , 2008)
[21375229] Enzymatic epoxide-opening cascades catalyzed by a pair of epoxide hydrolases in the ionophore polyether biosynthesis. (Org Lett. , 2011)
[22388816] Enzymatic catalysis of anti-Baldwin ring closure in polyether biosynthesis. (Nature. , 2012)
ACC
H1ZZU2
NITE
Salino_01000
PmId
[26377145] Enzymology of Pyran Ring A Formation in Salinomycin Biosynthesis. (Angew Chem Int Ed Engl. , 2015)

close this sectionPKS/NRPS Module

10 methylmalonyl-CoA
11
KS36..417
AT581..901
KR1217..1399
ACP1506..1576
KS1603..1974
at2134..2308
Cyc2430..2535

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MSSASSEKIVEALRASLTENERLRRLNQELAAAAHEPVAIVSMACRFPGGVESPEDFWDL
ISEGRDAVSGLPDNRGWDLDALYDPDPEAQGKTYVREGAFLYDAAEFDAELFGISPREAL
AMDPQQRLLMETSWEVLERAGIRPDSLRGKPVGVFTGGITSDYVTRHYASGTAPQLPSGV
ESHFMTGSAGSVFSGRIAYTYGFEGPAVTVDTACSSSLVALHMAAQSLRQGECSLAFAGG
VAVLPNPGTFVGFSRQRALSPDGRCKAFSADADGTGWGEGAGLVLLEKLSDARRNGHPVL
AILRGSAVNQDGASNGLTAPNGPSQQRVIRAALANARLSPDDVDVVEAHGTGTPLGDPIE
AQALQATYGRSRSAERPLWLGSVKSNVAHAQAAAGVASVIKVVMALRHRLLPKTLHADER
SPHIDWHSGAVELLTEAREWSRTEGRARRAGVSSFGISGTNAHVIIEEAPEPTVETTAAP
AAEPAAERSPVEVVPWVTSARSAAGLVAQADRLARFVGVRPELDPVDVGWSLVGSRSVLE
HRAVVLGRGRDELVAGLASLASGVSAPGVVCGVGRGGVRPVLVFPGQGSQWVGMAVGLLE
SSPVFAERLGECEAALAPFVEWSLRDVLGGGVGSVGLLERVDVVQPVLFAVMVSLAELWR
SVGVVPAAVVGHSQGEIAAACVAGGLSLGDAARVVALRSRALRRLSGLGGMVSVAAGRER
TEDLLAGWVGRVGVAAVNGPGSTVVSGDADALDELVVVCEGLGVRARRVAVDYASHSAHV
DLIREELGELLAPVVPVSSGVPFFSTVTGDWLDTARLDAGYWFENLRRPVRFGEATRALL
DEGFSVFIESSAHPVLATGISETVDAGDVPGAVVGSLRRGEGGMGRFLTSVAEAFVRGVE
VDWASVLPGGRRVDLPTYAFQRKHYWLESTAAEQNDPNALPADAADTRFWEAVESENLDE
LARTLDTAEARPALETLVPALASWRRQRREHSVVDSWRYRVGWRPAQISPRSDTTPTGTW
LVIAPAAHQEHPWVTAATESLRDGGAEVRTVVLDPTALQRDSLAQELGTDGAQIDGVLSL
LALDETPLPRHPGVPAGLGATLTLLQALGDAGIEAPLWCATQGAVSVSGVDHLTRPLQAQ
VWGLGRVAGLEHPDRWGGLVDLPETVDARSAGRLRALLAEPGDEDQLALRPSGAFVRRLT
RAPLEDTPPVREWRPDGTTLITGGTGGLGGHVARWLAAQGAGHLVLTSRRGPDADGAAEL
REELQGMGSRVSIVACDASDRNALGALLRRLRDEGTPVRAVVHTAGVAGRFTTLADADLA
DLAETLGAKAGGAAALDELLAGEGEPDAFVLFSSNAGVWGGAGQGPYAAANAYLDALAEQ
RRARGAAATSVAWGMWSGQGLVAGQPGVEEALRRLGLKAMDPDLAITALHQALDRDETTL
SVTDMDWDRFVSVFTAARPRPLLDELPEAARILRAAEAGHEANSESRSALAEQLAGLAPA
EQHRLLVEMVRAQAATVLGHDSGDAVDQDRQFQELGFNSVSAVELRNRLNEATGLRLPAS
LVFDHPTPAALARRIRAEVLGEAQEPAAAGLGGPAGGAAVGDDAVAIVGMSCRLPGGVES
PDDLWRVVVEGRDVISELPTDRAWEAVERLRELGMDMPGGRWLRAGGFIDSAAEFDPDFF
GVSTAEALAMDPQQRLLLEMSWEAIERAGIDPHTLRGSSTGVYVGTFFQPYWAGSNRIAE
DVKPFLGTGVTPTFASGRIAYLLGLEGPTFTVDTGCSSSAVALHQACQAVRRGECSTALV
GGVTVLSSPMGVPDLGGMAEDGRCKAFSAEADGTGWGEGAAMVMIERLSEARRLGHPVLA
VVRGSAVNHNGESNGMSAPNGPSQQRLIRQALADARLSPDEVDAVEAHGTGTPLGDPIEA
QALLATYGRDRAEDRPLWLGTVKTNIGHPQAASGLVGVIKMVLAMRHGLLPRSLYADSPT
PQVDWASGAVSLLAENTPWPEAGRPRRAGVSSFGASGTKAHIILEQDAWLPDAGTPEPAV
GTDGRTAAVPLLVSARTPDGVRQQARRLREFVESHPEAEPTDLAWSLATSRSAFEHRAAL
FAVDREELLGGLADLEQGDLLGRTLRGEAGATARTAFVFAGEALPDTPAPAARQLYEALP
DFADALDEACVHLDACARLGRPVQEFALGVHPAADAVAAACVAFAHESALSRALPRLGVT
PEVAAGLRLGEISAAHAAGVLGIEDAAALLVAVARLRDGAADREAALDGFGRTAKNIASH
PARLRLVSALTDEPLDAERLLDPGHWLDEETPVDVPTADGGRAPRVHGVFVGLPDGVPAG
SAGAVTGLMRVLARAHVDGVTVDWRETLTAVGAQGRSVELPTYSFRRDHYWLEANPVAVL
GDALAGKNVANWSAVEGVELLDETSRKEVVEEYFRRLNAGDLDKVLEMLAPDVRMEDPVG
GPPKLGREAVGEYIAQVIEANAEITVGPIVAAQDGLRVALPLVGRLAQLGRSDGPRMEIN
CVDVIQVNGEGLIQEVLVFWGMTDIAR
selected fasta
>polyketide synthase [polyketide synthase]
ATGAGCAGCGCATCCTCCGAGAAGATCGTCGAGGCACTGCGGGCGTCGCTCACCGAGAAC
GAACGCCTGCGCAGGCTCAATCAGGAACTGGCCGCGGCCGCGCACGAGCCGGTGGCCATC
GTGAGCATGGCCTGCCGGTTCCCCGGCGGCGTCGAATCCCCCGAGGACTTCTGGGACCTG
ATCAGCGAGGGCCGTGACGCGGTCTCCGGTCTGCCCGACAACCGCGGCTGGGACCTGGAC
GCGCTCTACGACCCCGACCCCGAGGCACAGGGCAAGACGTACGTCCGTGAAGGCGCCTTC
CTCTACGACGCGGCCGAGTTCGACGCGGAACTGTTCGGGATCTCGCCGCGTGAGGCGCTG
GCGATGGACCCGCAGCAGCGCCTGCTGATGGAGACCTCCTGGGAGGTCCTGGAACGGGCC
GGAATCAGGCCCGACTCGCTGCGCGGCAAGCCCGTCGGTGTCTTCACCGGCGGCATCACC
TCGGACTACGTGACCCGGCACTACGCGTCGGGCACCGCGCCGCAGCTCCCGTCGGGAGTC
GAGAGCCACTTCATGACCGGCAGCGCGGGCAGCGTCTTCTCGGGCCGTATCGCCTACACC
TACGGTTTCGAGGGGCCCGCGGTCACGGTGGACACCGCCTGCTCCTCGTCGCTGGTGGCA
CTGCACATGGCGGCCCAGTCGCTGCGCCAGGGCGAGTGCTCGCTGGCCTTCGCCGGCGGA
GTCGCCGTGCTGCCCAACCCCGGCACCTTCGTCGGCTTCAGCCGCCAGCGCGCACTGTCC
CCGGACGGCCGGTGCAAGGCGTTCTCCGCGGACGCCGACGGTACCGGCTGGGGCGAGGGC
GCGGGCCTCGTACTGCTGGAGAAGCTGTCCGACGCGCGCCGCAACGGCCACCCGGTCCTG
GCGATCCTGCGCGGCAGCGCCGTGAACCAGGACGGCGCCAGCAACGGCCTGACGGCGCCG
AACGGTCCGTCCCAGCAGCGCGTGATCCGGGCCGCGCTGGCGAACGCCCGCCTGTCGCCC
GACGACGTCGACGTCGTGGAGGCACACGGGACGGGCACCCCGCTCGGCGATCCGATCGAG
GCCCAAGCGCTGCAGGCCACGTACGGCAGGAGCCGCTCGGCCGAGCGCCCGCTGTGGCTG
GGCTCGGTGAAGTCGAACGTCGCCCACGCCCAGGCCGCGGCCGGAGTGGCCAGCGTGATC
AAGGTGGTCATGGCCCTGCGCCATCGCCTGTTGCCCAAGACGCTCCACGCCGACGAGCGC
TCGCCGCACATCGACTGGCACTCCGGCGCCGTCGAGCTGCTGACGGAGGCCCGCGAGTGG
TCGCGCACCGAGGGGCGTGCGCGCCGCGCCGGTGTGTCGTCGTTCGGGATCAGTGGGACG
AACGCGCACGTGATCATCGAGGAGGCGCCCGAGCCCACCGTCGAGACCACCGCCGCTCCG
GCTGCCGAGCCGGCTGCCGAGCGGTCTCCGGTCGAGGTGGTGCCGTGGGTGACGTCGGCA
CGCAGTGCCGCCGGTCTCGTTGCCCAGGCGGATCGGCTCGCCCGGTTCGTCGGTGTGCGG
CCGGAGCTGGATCCGGTGGATGTGGGGTGGTCGTTGGTTGGTTCGCGGTCGGTGCTGGAG
CACCGGGCGGTGGTGCTGGGCAGGGGCCGGGACGAGTTGGTGGCCGGTCTTGCCTCGCTT
GCCTCGGGAGTGTCCGCGCCGGGTGTGGTGTGTGGGGTGGGTCGGGGTGGTGTGCGGCCG
GTGTTGGTGTTTCCGGGGCAGGGGTCGCAGTGGGTGGGGATGGCGGTGGGGTTGTTGGAG
TCGTCGCCGGTGTTTGCGGAGCGGTTGGGGGAGTGTGAGGCGGCGTTGGCTCCGTTTGTG
GAGTGGTCGTTGCGGGATGTGTTGGGGGGTGGTGTGGGGTCGGTGGGGTTGTTGGAGCGG
GTTGATGTGGTGCAGCCGGTGTTGTTTGCGGTGATGGTGTCGTTGGCGGAGTTGTGGCGG
TCGGTGGGGGTGGTGCCGGCTGCGGTGGTGGGGCATTCGCAGGGGGAGATTGCTGCTGCG
TGTGTGGCGGGTGGTTTGTCGTTGGGTGATGCGGCGCGGGTGGTGGCGTTGCGGAGTCGG
GCGTTGCGGCGGTTGTCGGGGTTGGGTGGGATGGTGTCGGTGGCGGCGGGGCGGGAGCGG
ACGGAGGATCTGCTGGCCGGGTGGGTGGGTCGTGTGGGTGTTGCGGCGGTGAATGGTCCG
GGGTCGACGGTGGTGTCGGGTGATGCGGATGCGTTGGATGAGTTGGTGGTGGTGTGTGAG
GGGTTGGGGGTGCGGGCGCGTCGGGTTGCGGTGGATTATGCGTCGCATTCGGCTCATGTG
GATTTGATTCGGGAGGAGTTGGGGGAGTTGTTGGCGCCGGTTGTTCCGGTGTCTTCGGGG
GTGCCGTTCTTTTCGACGGTGACGGGTGACTGGCTCGACACGGCGCGGTTGGACGCGGGG
TATTGGTTTGAGAATCTTCGTCGGCCGGTGCGGTTCGGGGAGGCGACGCGTGCGTTGCTG
GATGAGGGTTTCTCGGTGTTCATCGAGTCGAGTGCGCATCCGGTGCTGGCGACGGGGATC
TCGGAGACGGTGGATGCGGGGGATGTGCCGGGTGCGGTGGTGGGTTCGCTGCGTCGGGGT
GAGGGGGGTATGGGGCGTTTCCTGACCTCGGTGGCGGAGGCGTTCGTCAGGGGTGTGGAG
GTGGACTGGGCGAGTGTGCTGCCCGGGGGTCGTCGGGTGGATCTGCCGACCTACGCCTTC
CAGCGCAAGCACTACTGGCTCGAGAGCACGGCTGCGGAACAGAACGACCCGAACGCTCTG
CCGGCCGACGCCGCCGACACCCGCTTCTGGGAGGCGGTCGAGAGCGAGAACCTCGACGAA
CTCGCCCGCACCCTCGACACCGCCGAAGCCCGGCCCGCCCTGGAGACCCTGGTACCTGCC
CTGGCCTCCTGGCGCAGGCAACGCCGGGAACACTCGGTCGTCGACTCCTGGCGCTACCGC
GTCGGTTGGCGTCCCGCACAGATCTCCCCGCGCTCCGACACCACACCTACCGGGACATGG
CTGGTGATCGCTCCCGCCGCCCACCAGGAACATCCGTGGGTGACGGCGGCGACCGAATCG
CTGCGCGACGGCGGCGCCGAGGTCCGGACGGTCGTACTGGACCCGACAGCGCTCCAACGT
GATTCACTGGCACAGGAGTTGGGCACAGACGGCGCGCAGATCGACGGGGTGCTGTCGCTG
CTCGCCCTGGACGAGACGCCGTTGCCCCGGCATCCCGGCGTTCCGGCCGGGCTCGGCGCG
ACCCTCACGCTGCTCCAGGCGCTGGGCGACGCCGGCATCGAGGCACCCCTGTGGTGCGCC
ACCCAGGGCGCCGTCTCCGTCAGCGGCGTCGATCACCTCACCCGGCCGCTTCAGGCGCAG
GTGTGGGGTCTGGGCCGAGTCGCGGGACTCGAGCACCCGGACCGCTGGGGCGGCCTCGTC
GACCTGCCCGAAACCGTCGACGCGCGGTCGGCGGGACGGCTGCGCGCCCTGCTGGCCGAG
CCGGGTGACGAGGACCAGCTCGCGCTGCGCCCCTCGGGCGCCTTCGTACGCCGCCTGACC
CGTGCGCCGCTGGAGGACACCCCGCCGGTACGCGAGTGGCGGCCCGACGGCACGACGCTG
ATCACCGGAGGGACCGGCGGTCTGGGCGGCCATGTGGCCCGATGGCTCGCCGCGCAGGGC
GCGGGGCACCTCGTCCTGACCAGCAGGCGTGGTCCGGACGCGGACGGTGCCGCCGAACTC
CGGGAGGAACTGCAGGGGATGGGCTCCCGGGTGAGCATCGTCGCCTGCGACGCGTCGGAC
CGGAACGCCCTGGGCGCGCTGCTGCGGCGGCTTCGCGACGAGGGGACCCCGGTGCGGGCG
GTCGTGCACACCGCCGGCGTCGCGGGCCGGTTCACCACGCTGGCCGACGCGGACCTGGCC
GACCTGGCCGAGACCCTGGGCGCGAAGGCCGGCGGGGCCGCGGCACTGGACGAACTGCTG
GCGGGAGAAGGCGAGCCGGACGCCTTCGTCCTCTTCTCGTCGAACGCCGGCGTGTGGGGC
GGCGCCGGACAGGGACCCTACGCCGCCGCGAACGCCTACCTCGACGCCCTGGCCGAGCAG
CGCCGCGCCCGCGGCGCCGCCGCCACCTCCGTCGCCTGGGGCATGTGGAGCGGACAGGGA
CTGGTGGCCGGTCAGCCCGGCGTCGAGGAAGCACTGCGACGCCTGGGCCTGAAGGCCATG
GACCCGGACCTGGCGATCACGGCACTGCACCAGGCCCTCGACCGCGACGAGACCACCCTC
TCCGTCACCGACATGGACTGGGACCGCTTCGTCTCGGTGTTCACGGCGGCACGTCCGCGC
CCCCTCCTCGACGAACTGCCCGAAGCCGCAAGGATCCTGCGCGCCGCCGAAGCGGGCCAC
GAGGCGAACTCCGAGTCCCGTTCGGCCCTCGCCGAACAACTGGCCGGCCTGGCTCCCGCC
GAGCAGCACCGCCTCCTCGTGGAGATGGTGCGTGCCCAGGCCGCGACCGTGCTGGGCCAC
GACTCCGGAGACGCGGTCGACCAGGACCGGCAGTTCCAGGAGCTCGGGTTCAACTCGGTG
AGCGCGGTGGAACTGCGCAACCGGCTCAACGAGGCGACCGGGCTGCGCCTGCCGGCCTCG
CTGGTCTTCGACCACCCGACGCCCGCCGCGCTGGCCCGCCGGATACGCGCCGAGGTGCTG
GGCGAAGCGCAGGAGCCGGCCGCCGCCGGCCTCGGCGGCCCGGCCGGCGGTGCCGCCGTC
GGTGACGACGCCGTGGCCATCGTCGGCATGAGCTGCCGGCTGCCCGGCGGCGTGGAGAGC
CCCGACGACCTGTGGCGCGTCGTCGTCGAAGGCCGCGACGTGATCTCCGAGCTGCCGACC
GACCGGGCCTGGGAGGCGGTCGAGCGGCTGCGGGAACTCGGGATGGACATGCCCGGGGGG
CGCTGGCTGCGCGCGGGCGGATTCATCGACTCCGCGGCCGAGTTCGACCCGGACTTCTTC
GGCGTCTCCACGGCCGAGGCGCTGGCGATGGATCCGCAGCAGCGGCTGCTGCTGGAGATG
TCCTGGGAGGCGATCGAGCGGGCCGGCATCGACCCGCACACCCTGCGAGGCAGCTCCACC
GGCGTGTACGTCGGCACGTTCTTCCAGCCGTACTGGGCGGGCTCCAACCGCATCGCGGAG
GACGTCAAGCCCTTCCTCGGCACCGGCGTCACCCCGACGTTCGCCTCCGGCCGCATCGCC
TACCTCCTCGGCCTCGAAGGCCCCACGTTCACCGTGGACACCGGCTGCTCGTCCTCGGCC
GTCGCCCTGCACCAGGCGTGCCAGGCGGTGCGTCGCGGGGAGTGCTCGACGGCGCTGGTC
GGCGGTGTCACCGTGCTGTCCAGCCCGATGGGCGTGCCCGACCTCGGCGGCATGGCCGAG
GACGGCCGCTGCAAGGCGTTCTCCGCCGAGGCCGACGGCACCGGCTGGGGTGAGGGAGCC
GCGATGGTCATGATCGAACGGCTCTCCGAGGCGCGCCGCCTGGGCCACCCGGTCCTCGCG
GTGGTCCGCGGCTCCGCCGTCAACCACAACGGCGAGAGCAACGGCATGTCGGCCCCCAAC
GGCCCGTCCCAACAGCGGCTGATCCGCCAGGCCCTGGCCGACGCGCGGCTGTCGCCCGAC
GAGGTCGACGCGGTGGAGGCGCACGGCACCGGCACCCCGCTCGGCGACCCGATCGAGGCC
CAGGCGCTGCTGGCCACCTACGGCCGGGACCGGGCGGAGGACCGGCCGCTGTGGCTCGGC
ACGGTCAAGACCAACATCGGCCACCCGCAGGCGGCGTCCGGCCTGGTCGGCGTCATCAAG
ATGGTGCTGGCCATGCGCCACGGACTGCTTCCCCGGTCCCTGTACGCCGACTCGCCGACA
CCGCAGGTCGACTGGGCGTCCGGCGCCGTCTCGCTGCTGGCCGAGAACACGCCGTGGCCG
GAGGCCGGACGGCCTCGCAGGGCCGGTGTCTCCTCCTTCGGCGCCAGCGGCACCAAGGCC
CACATCATCCTCGAACAGGATGCCTGGCTGCCCGACGCGGGCACGCCGGAACCCGCGGTC
GGCACCGACGGCCGGACCGCCGCCGTACCCCTGCTGGTGTCCGCCCGCACACCGGACGGT
GTCCGCCAACAGGCCCGCAGGCTGCGCGAGTTCGTGGAGTCACACCCCGAGGCGGAACCG
ACGGACCTCGCCTGGTCCCTGGCGACCTCGCGCTCGGCGTTCGAGCACCGGGCCGCACTG
TTCGCGGTCGACCGGGAGGAACTGCTCGGCGGGCTCGCGGATCTGGAGCAGGGAGACCTC
CTGGGCCGCACCCTCCGGGGCGAGGCCGGGGCCACGGCGCGCACCGCGTTCGTCTTCGCC
GGCGAGGCGCTGCCCGACACCCCGGCTCCCGCCGCACGGCAGCTGTACGAAGCGCTGCCG
GACTTCGCCGACGCACTGGACGAGGCGTGCGTCCACCTCGACGCCTGCGCCCGACTGGGC
CGTCCGGTACAGGAGTTCGCCCTCGGCGTTCACCCTGCCGCCGACGCGGTGGCCGCCGCC
TGCGTCGCGTTCGCCCACGAGTCGGCACTGTCCCGGGCGCTGCCGCGGCTGGGCGTGACA
CCGGAGGTCGCGGCGGGGCTCCGCCTGGGGGAGATCAGCGCGGCGCACGCCGCCGGAGTC
CTGGGGATCGAGGACGCCGCCGCGCTCCTCGTGGCCGTGGCGCGGCTGCGTGACGGCGCG
GCCGATCGGGAGGCCGCTCTCGACGGGTTCGGCCGGACGGCGAAGAACATCGCGTCGCAC
CCGGCACGGCTCCGCCTGGTGTCCGCCCTGACCGACGAGCCGCTCGACGCCGAACGGCTG
CTGGATCCCGGGCACTGGCTGGACGAGGAGACCCCCGTGGACGTGCCGACGGCGGACGGC
GGCCGGGCGCCGCGCGTCCACGGCGTGTTCGTCGGCCTCCCGGACGGTGTACCCGCCGGA
TCGGCCGGGGCCGTGACCGGCCTGATGCGGGTACTGGCCCGGGCACACGTCGACGGAGTG
ACCGTCGACTGGCGGGAGACGCTGACCGCGGTGGGCGCCCAGGGGCGGTCGGTGGAGCTG
CCCACCTACTCCTTCCGGCGCGACCACTACTGGCTGGAGGCGAACCCGGTGGCGGTCCTG
GGGGACGCTCTCGCCGGGAAGAACGTCGCCAACTGGAGCGCGGTGGAAGGAGTGGAGCTC
CTCGACGAGACCTCGCGCAAGGAGGTCGTGGAGGAGTACTTCCGCCGGCTCAACGCGGGC
GATCTCGACAAGGTGCTGGAGATGCTGGCACCCGACGTCCGCATGGAGGACCCCGTCGGC
GGACCGCCCAAGCTCGGGCGCGAGGCCGTCGGGGAGTACATCGCGCAGGTCATCGAGGCC
AACGCCGAGATCACCGTCGGCCCGATCGTCGCGGCCCAGGACGGCCTCCGGGTCGCGCTG
CCGCTGGTCGGACGACTCGCCCAGCTCGGCAGGTCCGACGGCCCGCGCATGGAGATCAAC
TGCGTGGACGTCATCCAGGTCAACGGCGAAGGACTGATCCAGGAAGTGCTGGTTTTCTGG
GGCATGACGGACATCGCCCGCTGA
[10] KS36..417
[10] AT581..901
[10] methylmalonyl-CoA773..777
[10] KR1217..1399
[10] ACP1506..1576
[11] KS1603..1974
[11] at2134..2308
[11] Cyc2430..2535
[10] KS106..1251
[10] AT1741..2703
[10] methylmalonyl-CoA2317..2331
[10] KR3649..4197
[10] ACP4516..4728
[11] KS4807..5922
[11] at6400..6924
[11] Cyc7288..7605

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [579-705]  1.9e-88 G3DSA:3.40.366.10 [773-890]  1.9e-88 G3DSA:3.40.366.10 [2129-2308]  1.9e-88 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1534-1549]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1499-1619]  4.60000044330862e-26 SSF47336
SSF47336   ACP_like
 [1510-1575]  7.4e-13 PF00550
PF00550   PP-binding
 [1506-1576]  PS50075
PS50075   ACP_DOMAIN
 [1506-1579]  7.29999999999999e-22 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR009959 Polyketide cyclase SnoaL-like domain (Domain)
 [2430-2535]  4.70000000000001e-12 PF12680
PF12680   SnoaL_2
IPR013968 Polyketide synthase, KR (Domain)
 [1217-1398]  8.30000000000004e-58 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [36-292]  1.29999999999998e-96 PF00109 [1603-1851]  1.60000000000002e-78 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [300-417]  2.99999999999998e-47 PF02801 [1859-1974]  7.69999999999997e-45 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [581-901]  1e-100 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [579-884]  3.89999861795218e-65 SSF52151 [2134-2308]  5.00000909915354e-17 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [707-772]  2.39999798157265e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [38-304]  G3DSA:3.40.47.10 [305-471]  3.30000000000002e-127 G3DSA:3.40.47.10 [1603-1862]  G3DSA:3.40.47.10 [1863-2026]  3.30000000000002e-127 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [28-416]  5.79999653854781e-103 SSF53901 [1602-1973]  3.39999972437719e-94 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1216-1413]  2.19999999999997e-33 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [205-221]  PS00606 [1767-1783]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [583-881]  2.1000026783403e-119 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1507-1579]  1e-33 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [38-471]  SM00825 [1605-2029]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1217-1399]  2.1000026783403e-43 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit