close all open/close all

CDS information : Indano_00210


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction75,583 / 77,058 / + [in whole cluster]
75,583 / 77,058 / + [in contig]
Location75583..77058 [in whole cluster]
75583..77058 [in contig]
TypeCDS
Length1,476 bp (491 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in indanomycin biosynthesis.
Note (GenBank)
  • Orf21
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MGGGTRPAWPLHWAEGIGSNPAAPDELLIRLLDVAEGFLHDCDRPAVLDAAVAHPDPRVR
SRPADTFRPKLTPEQWVRLIRAEPSPSRRVHWAEHAGAWGVELPGDLCDDLLADPSRAQA
AGLRGIPAHHLPSLADDADPRVRTAACARWEDLAAPLRKRLLADTDDAVRTAALLAHHTG
IPMPREVFDALPTPRSALEQCRLEPELEAESVADGDADVRRALAANPGLGPHGIAVLAKD
SLDDIRSAVALRPDLTEEQRALVRYSFDPTSMSRTLPWVADLHGDAEAMRRLAASSHPLI
RRSVARARHLPPDVVERLARDEDRMVRLFLAESCDGAPADLLLEVWRWWDGSFSHPDRPR
SHPNFPRTGLLRHADDSDGRMRRLALDDPESTSADVAHLARDPEAEVRRRAAEDLRLPPA
DAVRLLDDPADHVRWAAMRNPRLPARVLAGLLHDRDTSSVAVTNPAIPVPVLHRILATAA
AAAAAAVSARC
selected fasta
>hypothetical protein [hypothetical protein]
GTGGGCGGCGGTACCCGGCCGGCCTGGCCCTTGCACTGGGCGGAGGGGATCGGCTCCAAT
CCGGCCGCGCCGGACGAGCTGCTGATCCGGCTGCTGGATGTGGCGGAGGGGTTCCTGCAC
GACTGTGACCGGCCCGCCGTACTCGACGCCGCCGTGGCGCACCCCGATCCGCGGGTGCGC
TCGAGGCCCGCCGACACCTTCCGGCCCAAGCTCACGCCCGAACAATGGGTACGCCTGATC
CGCGCCGAACCGTCGCCGAGCCGGCGCGTGCACTGGGCCGAGCACGCCGGCGCCTGGGGC
GTCGAACTCCCCGGGGACCTGTGCGACGACCTCCTCGCCGACCCGTCCCGCGCCCAGGCC
GCCGGACTCCGGGGGATCCCCGCACACCACCTCCCCAGCCTCGCGGACGACGCCGATCCC
CGGGTACGGACCGCTGCCTGCGCCCGGTGGGAAGACCTCGCCGCGCCACTGCGGAAGCGG
CTGCTGGCCGACACCGACGACGCGGTGCGCACGGCGGCGCTACTGGCCCACCACACCGGC
ATCCCCATGCCCCGCGAGGTCTTCGACGCGCTGCCCACGCCCCGGAGCGCCCTCGAACAG
TGCCGCCTCGAGCCCGAGTTGGAGGCGGAGTCGGTCGCGGACGGGGACGCGGACGTGCGC
CGGGCGCTTGCCGCCAACCCGGGCCTGGGCCCGCACGGCATCGCCGTCCTGGCGAAGGAC
TCCCTGGACGACATACGTTCCGCGGTGGCACTGCGCCCCGATCTCACCGAGGAGCAGCGC
GCCCTGGTGCGCTACAGCTTCGACCCGACGTCGATGTCGCGCACCCTGCCCTGGGTCGCG
GACCTGCACGGTGACGCCGAGGCGATGCGCCGCCTGGCCGCGTCGTCCCATCCGCTCATC
CGCCGCAGTGTGGCCCGTGCCCGGCATCTCCCACCGGACGTCGTGGAGCGTCTGGCGCGG
GACGAGGACCGGATGGTCCGCCTGTTCCTGGCCGAATCGTGCGACGGCGCGCCGGCCGAC
CTGCTCTTGGAGGTCTGGCGGTGGTGGGACGGCAGCTTCAGCCACCCCGACCGCCCCCGC
AGCCACCCCAACTTCCCCCGTACGGGCCTGCTGCGCCACGCAGACGACTCCGACGGGCGG
ATGCGCCGCTTGGCCCTGGACGATCCGGAGTCCACGTCGGCCGACGTCGCACACCTGGCC
CGCGACCCCGAAGCCGAGGTGCGCCGCCGTGCGGCCGAGGACCTCCGGCTGCCTCCGGCC
GACGCGGTGCGGCTGCTGGACGACCCGGCGGACCACGTCCGCTGGGCCGCGATGCGCAAT
CCACGGCTGCCGGCCCGCGTCCTGGCCGGGCTGCTGCACGACCGCGACACGTCAAGCGTG
GCGGTCACCAACCCGGCGATCCCGGTACCCGTCCTGCACCGGATCCTGGCCACGGCAGCG
GCAGCGGCAGCGGCAGCGGTGTCGGCCCGGTGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011989 Armadillo-like helical (Domain)
 [104-335]  2.7e-27 G3DSA:1.25.10.10 [369-476]  2.7e-27 G3DSA:1.25.10.10
G3DSA:1.25.10.10   ARM-like
IPR016024 Armadillo-type fold (Domain)
 [308-456]  2.59999946718995e-07 SSF48371
SSF48371   ARM-type_fold
SignalP No significant hit
TMHMM No significant hit