close all open/close all
Indano_00220 Indano_00220   last last

CDS information : Indano_00230


close this sectionLocation

Organism
StrainNRRL 8167
Entry nameIndanomycin
Contig
Start / Stop / Direction79,100 / 79,501 / + [in whole cluster]
79,100 / 79,501 / + [in contig]
Location79100..79501 [in whole cluster]
79100..79501 [in contig]
TypeCDS
Length402 bp (133 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative replication initiation protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in indanomycin biosynthesis.
Note (GenBank)
  • Orf23
Reference
ACC
PmId
[19301315] Analysis of the indanomycin biosynthetic gene cluster from Streptomyces antibioticus NRRL 8167. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [putative replication initiation protein]
MSSLIDADEISHEVALVWLEDVDQLDYVRQSLDRLPTRKGKPAYHRDGRMVGYAILGPDA
KASRASGTFRRRVFWVLPHDRDTEPDGLYAMSAPAEAVDPRTLEPRVKGCKTERSEGGPP
SLAMQELGIQLPL
selected fasta
>hypothetical protein [putative replication initiation protein]
ATGAGTTCCCTGATCGATGCGGACGAGATCAGCCACGAAGTCGCCCTCGTATGGCTGGAG
GACGTCGACCAGCTCGACTACGTGCGCCAGAGCCTGGACCGGCTGCCCACCCGCAAGGGC
AAGCCCGCCTACCACCGCGACGGCCGCATGGTCGGCTACGCCATCCTCGGCCCCGACGCC
AAAGCCTCCCGCGCCTCAGGCACATTCCGCCGCCGCGTCTTCTGGGTCCTGCCCCACGAC
CGCGACACCGAGCCCGACGGCCTGTACGCAATGAGCGCTCCCGCCGAAGCCGTCGATCCG
CGCACCCTCGAACCCCGCGTCAAGGGCTGCAAAACCGAACGCTCCGAAGGCGGCCCGCCT
TCTCTCGCCATGCAGGAACTCGGCATACAGCTCCCGCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-30]  0.051 Signal
Eukaryota   
TMHMM No significant hit
Indano_00220 Indano_00220   last last