close all open/close all

CDS information : Jado_00010


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction195 / 1,124 / + [in whole cluster]
195 / 1,124 / + [in contig]
Location195..1124 [in whole cluster]
195..1124 [in contig]
TypeCDS
Length930 bp (309 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.6 biosynthesis of butyrolactone
Productputative gamma-butyrolactone biosynthesis enzyme
putative regulatory protein
Product (GenBank)JadW1
Gene
Gene (GenBank)jadW1
EC number
Keyword
Note
Note (GenBank)
  • similar to BarX and AfsA
Reference
ACC
PmId
[12904539] Control of growth, secondary metabolism and sporulation in Streptomyces venezuelae ISP5230 by jadW(1), a member of the afsA family of gamma-butyrolactone regulatory genes. (Microbiology. , 2003)
[25116816] A gamma-butyrolactone-sensing activator/repressor, JadR3, controls a regulatory mini-network for jadomycin biosynthesis. (Mol Microbiol. , 2014)
Related Reference
ACC
O24738
NITE
Virg_00330
PmId
[10792718] Identification of an AfsA homologue (BarX) from Streptomyces virginiae as a pleiotropic regulator controlling autoregulator biosynthesis, virginiamycin biosynthesis and virginiamycin M1 resistance. (Mol Microbiol. , 2000)
[19778967] Null mutation analysis of an afsA-family gene, barX, that is involved in biosynthesis of the {gamma}-butyrolactone autoregulator in Streptomyces virginiae. (Microbiology. , 2010)
ACC
F2RC04
PmId
[25116816] A gamma-butyrolactone-sensing activator/repressor, JadR3, controls a regulatory mini-network for jadomycin biosynthesis. (Mol Microbiol. , 2014)

close this sectionSequence

selected fasta
>putative gamma-butyrolactone biosynthesis enzyme [JadW1]
MHTTSRGEFVHRADPADIIPTDWTQLRQNRFSVSARVACLRSLLLSRAGARHDPMLVAET
IPETSMLVAHAELGVPLDEQFVMWDLSYSADSEALTVDGLSSDVTVDVVCSDITRRGSRL
RNLRTTVVLTRDDRLLATGSGTARCTSALAYRRMRGERMEALGRPVPLIPGVHPRLVGRA
RTEDVVLAPGNRPDQWQLRVNTAHTTLFRRPNDHVPGMVLLEAARQAATATTGSAAYLPT
DLSVSFLRYVELDSPCWIEAESVPTPDPSTTTIRVTGHQDGSPVFRCTLTSPSRELSVAT
AGLDTRLAG
selected fasta
>putative gamma-butyrolactone biosynthesis enzyme [JadW1]
GTGCACACCACGTCCCGAGGGGAATTCGTTCACCGCGCCGATCCCGCGGACATCATTCCC
ACGGACTGGACGCAGCTCCGGCAGAATCGGTTCTCCGTATCCGCCCGCGTGGCCTGCCTC
AGATCCCTTCTTCTCTCCCGTGCCGGGGCCCGGCACGACCCCATGCTGGTGGCCGAGACG
ATACCCGAGACCAGCATGCTGGTCGCTCACGCCGAGCTGGGGGTACCCCTGGACGAACAG
TTCGTCATGTGGGACCTCTCCTACAGCGCCGACTCCGAGGCGCTCACGGTGGACGGCCTC
TCCTCCGACGTCACCGTCGACGTCGTCTGCTCCGACATCACCCGCCGCGGCAGCCGCCTC
CGCAACCTCCGCACCACCGTGGTGCTCACCCGCGACGACCGGCTCCTCGCCACCGGCAGC
GGCACGGCCCGCTGCACCTCCGCCCTGGCGTACCGCCGGATGCGCGGCGAGCGGATGGAG
GCGCTGGGCAGACCCGTGCCCCTCATACCCGGCGTGCACCCGCGCCTCGTCGGCCGCGCG
CGGACCGAGGACGTCGTCCTCGCCCCCGGAAACCGGCCCGACCAGTGGCAGTTGCGCGTC
AACACCGCGCACACCACCCTCTTCCGCCGCCCGAACGACCACGTGCCCGGGATGGTGCTC
CTGGAGGCGGCCCGGCAGGCGGCGACCGCCACGACCGGCAGCGCGGCCTATCTGCCCACC
GACCTGAGCGTCTCCTTCCTGCGCTACGTCGAGCTCGACAGCCCCTGCTGGATCGAGGCC
GAGTCCGTGCCCACCCCGGACCCCTCGACGACCACCATCCGGGTCACCGGCCACCAGGAC
GGCAGCCCCGTCTTCCGCTGTACGCTCACCTCCCCGTCCCGGGAACTGTCGGTGGCCACC
GCCGGACTCGACACCCGGCTGGCGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005509 A-factor biosynthesis hotdog domain (Domain)
 [9-145]  1.80000000000002e-34 PF03756 [176-292]  1.40000000000001e-37 PF03756
PF03756   AfsA
SignalP No significant hit
TMHMM No significant hit