close all open/close all

CDS information : Jado_00020


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction1,139 / 2,086 / + [in whole cluster]
1,139 / 2,086 / + [in contig]
Location1139..2086 [in whole cluster]
1139..2086 [in contig]
TypeCDS
Length948 bp (315 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)JadW2
Gene
Gene (GenBank)jadW2
EC number
Keyword
Note
Note (GenBank)
  • dehydrogenase; repressor
Reference
ACC
PmId
[12904539] Control of growth, secondary metabolism and sporulation in Streptomyces venezuelae ISP5230 by jadW(1), a member of the afsA family of gamma-butyrolactone regulatory genes. (Microbiology. , 2003)
[17653711] Engineering a regulatory region of jadomycin gene cluster to improve jadomycin B production in Streptomyces venezuelae. (Appl Microbiol Biotechnol. , 2007)
[25116816] A gamma-butyrolactone-sensing activator/repressor, JadR3, controls a regulatory mini-network for jadomycin biosynthesis. (Mol Microbiol. , 2014)
Related Reference
ACC
Q9LBV2
NITE
Virg_00320
PmId
[18034227] Identification by gene deletion analysis of barS2, a gene involved in the biosynthesis of gamma-butyrolactone autoregulator in Streptomyces virginiae. (Arch Microbiol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [JadW2]
MGPRILITGATGFIGGRVAAAAATAREPAHVRLLARGPLTGPAAAAGPRTETAVGDLRDP
ASLRRACEGVDVLIHCASAIGGDAELARAVNDEGTRNLVDAAVRAGATRIVGPEHRLRTR
RGPFRAAAPGTLPLAPGSVTSSTRAAGERHVMDAGGTVLRPHLVYGTGDRRLLPGLVRLL
AALPGPLDGGSSLHSLIDVDSLAGALLGAALSPATEPGPYYVDHPEPVPVGDLLAAAESL
LTRTGLPRGRAVDLPTARRLLAGLPFAGHHLDMLATDHWFADDRPWRELGCDPGPGLPRG
SRTTRRGTTDSSTIP
selected fasta
>hypothetical protein [JadW2]
ATGGGCCCTCGCATCCTGATCACCGGCGCCACCGGATTCATCGGCGGCCGCGTGGCCGCC
GCGGCCGCCACCGCGCGGGAGCCCGCCCACGTACGGCTGCTCGCCCGCGGCCCGCTCACC
GGCCCGGCCGCGGCCGCCGGACCGCGGACCGAGACCGCCGTCGGCGACCTCCGCGACCCC
GCGTCCCTGCGCCGCGCCTGCGAGGGCGTCGACGTACTGATCCACTGCGCCTCCGCGATC
GGCGGGGACGCGGAACTGGCCCGGGCGGTCAACGACGAGGGCACCCGGAACCTCGTCGAC
GCCGCCGTCCGCGCCGGGGCGACCCGGATCGTCGGCCCTGAGCACCGCCTCCGTACACGG
CGCGGCCCCTTCCGCGCCGCCGCCCCCGGCACCTTGCCGCTCGCCCCCGGCTCGGTGACC
AGCAGCACCCGGGCGGCCGGCGAGCGGCACGTCATGGACGCCGGCGGGACCGTACTGCGA
CCGCACCTGGTGTACGGCACCGGGGACCGCCGGCTGTTGCCCGGCCTGGTCCGGCTCCTC
GCCGCGCTGCCGGGACCGCTCGACGGCGGGTCCTCGCTGCACTCCCTGATCGACGTCGAC
AGCCTGGCGGGCGCGCTGCTCGGCGCGGCCCTCTCCCCGGCGACGGAGCCGGGACCGTAC
TACGTCGACCATCCCGAACCGGTGCCGGTCGGCGACCTCCTCGCGGCCGCCGAGTCCCTG
CTGACCCGCACGGGCCTCCCCCGGGGACGGGCCGTGGACCTCCCGACCGCCCGCAGGCTG
CTCGCCGGCCTCCCCTTCGCGGGGCACCACCTGGACATGCTCGCCACCGACCACTGGTTC
GCCGACGACCGCCCCTGGCGGGAGCTCGGCTGCGACCCGGGGCCGGGCTTACCACGGGGT
TCGCGGACCACGCGGCGTGGTACCACGGACTCCTCGACCATTCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016040 NAD(P)-binding domain (Domain)
 [1-242]  3.29999999999997e-39 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-21]  0.988 Signal
Bacteria, Gram-negative   
 [1-21]  0.986 Signal
Bacteria, Gram-positive   
 [1-20]  0.935 Signal
Eukaryota   
TMHMM No significant hit