close all open/close all

CDS information : Jado_00030


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction2,109 / 2,873 / + [in whole cluster]
2,109 / 2,873 / + [in contig]
Location2109..2873 [in whole cluster]
2109..2873 [in contig]
TypeCDS
Length765 bp (254 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative C-6 ketoreductase
Product (GenBank)jadW3
GenejadW3
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • dehydrogenase/reductases; regulator for jadomycin B biosynthesis
Reference
ACC
PmId
[12904539] Control of growth, secondary metabolism and sporulation in Streptomyces venezuelae ISP5230 by jadW(1), a member of the afsA family of gamma-butyrolactone regulatory genes. (Microbiology. , 2003)
[17653711] Engineering a regulatory region of jadomycin gene cluster to improve jadomycin B production in Streptomyces venezuelae. (Appl Microbiol Biotechnol. , 2007)
[25116816] A gamma-butyrolactone-sensing activator/repressor, JadR3, controls a regulatory mini-network for jadomycin biosynthesis. (Mol Microbiol. , 2014)
Related Reference
ACC
Q9ZGC1
NITE
Lando_00190
PmId
[16283688] LanV, a bifunctional enzyme: aromatase and ketoreductase during landomycin A biosynthesis. (Chembiochem. , 2005)
[22633416] Tailoring enzymes involved in the biosynthesis of angucyclines contain latent context-dependent catalytic activities. (Chem Biol. , 2012)
[22454092] Elucidation of post-PKS tailoring steps involved in landomycin biosynthesis. (Org Biomol Chem. , 2012)

close this sectionSequence

selected fasta
>putative C-6 ketoreductase [jadW3]
MSALAGRTAIVTGASRGIGRGIAERLATDGALVAVHYGSNEKAALETVEIIEGRGGRAFA
FRAELGAPDAVDTFYAALDAGLAERGAAREFDILVNNAAASGSGRIHQLTTEVFDRLFAI
NVKAPLFLVQRGLDRLRDGGRIVNISSAATKHAFPDSVTYAMTKGAVDTMTLALAKELGP
RGITVNAVAPGYIATDMNARRRATPEASAALAAMSVFNRIGTPAADVGRGRFPVSDEARW
ITGQYVDATGGTAL
selected fasta
>putative C-6 ketoreductase [jadW3]
ATGTCCGCGCTGGCCGGCAGGACCGCGATCGTCACAGGGGCGAGCCGCGGCATCGGAAGA
GGCATCGCCGAGCGACTTGCCACGGACGGCGCCCTGGTCGCCGTCCACTACGGCAGCAAC
GAGAAGGCGGCCCTGGAGACGGTGGAGATCATCGAGGGGCGGGGCGGCCGCGCCTTCGCG
TTCCGCGCGGAACTCGGGGCGCCGGACGCCGTCGACACCTTCTACGCCGCCCTCGACGCG
GGCCTCGCGGAGCGGGGCGCGGCGCGGGAGTTCGACATCCTCGTCAACAACGCGGCCGCG
AGCGGCTCGGGCCGCATCCACCAGCTCACCACCGAGGTGTTCGACCGGCTGTTCGCCATC
AATGTGAAAGCCCCGCTCTTCCTGGTCCAGCGGGGCCTCGACCGGCTGCGGGACGGCGGC
CGGATCGTCAACATCTCCTCGGCGGCCACGAAGCACGCCTTCCCCGACTCCGTCACCTAC
GCGATGACGAAGGGCGCCGTCGACACGATGACCCTCGCCCTCGCCAAGGAGCTGGGGCCG
CGGGGGATCACCGTCAACGCGGTGGCCCCCGGCTACATCGCGACGGACATGAACGCCCGC
CGCAGGGCCACCCCGGAGGCGAGCGCGGCCCTCGCGGCGATGTCCGTCTTCAACCGGATC
GGCACGCCCGCCGCCGACGTCGGACGTGGTCGGTTTCCTGTCTCCGACGAAGCCCGGTGG
ATCACCGGCCAGTACGTGGACGCCACCGGGGGGACGGCGCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [8-178]  1e-26 PF00106
PF00106   adh_short
 [89-100]  7.30000590915208e-09 PR00080 [140-148]  7.30000590915208e-09 PR00080 [160-179]  7.30000590915208e-09 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [8-25]  4.70000326671387e-29 PR00081 [89-100]  4.70000326671387e-29 PR00081 [134-150]  4.70000326671387e-29 PR00081 [160-179]  4.70000326671387e-29 PR00081 [181-198]  4.70000326671387e-29 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [2-252]  6.7999999999999e-67 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [147-175]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-23]  0.193 Signal
Bacteria, Gram-positive   
TMHMM No significant hit