close all open/close all

CDS information : Jado_00040


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction3,543 / 2,953 / - [in whole cluster]
3,543 / 2,953 / - [in contig]
Locationcomplement(2953..3543) [in whole cluster]
complement(2953..3543) [in contig]
TypeCDS
Length591 bp (196 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductTetR family transcriptional repressor
Product (GenBank)JadR2
Gene
Gene (GenBank)jadR2
EC number
Keyword
Note
Note (GenBank)
  • pseudo gamma-butyrolactone receptor; repressor for jadomycin biosynthesis
Reference
ACC
PmId
[7592375] Regulation of jadomycin B production in Streptomyces venezuelae ISP5230: involvement of a repressor gene, jadR2. (J Bacteriol. , 1995)
[20562102] "Pseudo" gamma-butyrolactone receptors respond to antibiotic signals to coordinate antibiotic biosynthesis. (J Biol Chem. , 2010)
[23832247] JadR and jadR2 act synergistically to repress jadomycin biosynthesis. (Sci China Life Sci. , 2013)
[25116816] A gamma-butyrolactone-sensing activator/repressor, JadR3, controls a regulatory mini-network for jadomycin biosynthesis. (Mol Microbiol. , 2014)

close this sectionSequence

selected fasta
>TetR family transcriptional repressor [JadR2]
MTKQERATRTRDALIKSAAREFDEHGYALAKLSAISSGAGVSPGALHFHFENKVAAAVEI
DASTTLRRTARIVYHQRSNALQNLADTTHALARLVREDVVVRAGFRLSCSQLCGTDLNLR
QEWQSCVQQRLAEAADEGLLASDIGGQQDLARTIVAATIGLEALCRDNGEWLSPGTVTGL
WRTLLPIVAAPGRSPP
selected fasta
>TetR family transcriptional repressor [JadR2]
GTGACCAAACAAGAGCGGGCCACACGGACGCGCGACGCCCTGATCAAGTCGGCGGCCAGA
GAATTCGACGAGCACGGCTACGCCCTGGCCAAGTTGTCGGCGATCAGTTCGGGAGCGGGC
GTGAGCCCCGGCGCCCTCCACTTCCACTTCGAGAACAAGGTGGCCGCAGCCGTCGAGATC
GACGCGTCCACCACACTGCGCCGGACCGCCAGGATCGTGTACCACCAGCGGTCGAACGCC
CTGCAGAACCTCGCCGACACCACCCATGCGCTGGCCCGGCTCGTCCGCGAGGACGTCGTC
GTGCGCGCGGGGTTCCGGCTGAGCTGCTCCCAGCTCTGCGGTACGGACCTCAACCTGCGC
CAGGAATGGCAGAGCTGCGTCCAGCAGCGGCTCGCGGAGGCCGCCGACGAGGGCCTGCTC
GCCTCGGACATCGGTGGTCAACAGGACCTCGCCCGCACGATCGTGGCCGCCACCATCGGC
CTGGAGGCCCTCTGCCGGGACAACGGCGAATGGCTGTCGCCCGGCACCGTCACCGGCCTG
TGGCGGACCCTCCTCCCCATCGTCGCGGCCCCCGGGCGCTCGCCGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [14-27]  3.00000067992871e-06 PR00455 [35-58]  3.00000067992871e-06 PR00455
PR00455   HTHTETR
 [8-68]  PS50977
PS50977   HTH_TETR_2
 [14-55]  9.5e-11 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [1-84]  4.09999599045784e-10 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [78-192]  3.69999438558106e-21 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [1-191]  8.20000000000006e-30 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP No significant hit
TMHMM No significant hit