close all open/close all

CDS information : Jado_00050


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction4,113 / 4,892 / + [in whole cluster]
4,113 / 4,892 / + [in contig]
Location4113..4892 [in whole cluster]
4113..4892 [in contig]
TypeCDS
Length780 bp (259 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional regulator
Product (GenBank)JadR1
Gene
Gene (GenBank)jadR1
EC number
Keyword
Note
Note (GenBank)
  • atypical response regulator; activator for jadomycin biosynthesis
Reference
ACC
PmId
[11733141] A repressor-response regulator gene pair controlling jadomycin B production in Streptomyces venezuelae ISP5230. (Gene. , 2001)
[19423672] Autoregulation of antibiotic biosynthesis by binding of the end product to an atypical response regulator. (Proc Natl Acad Sci U S A. , 2009)
[20562102] "Pseudo" gamma-butyrolactone receptors respond to antibiotic signals to coordinate antibiotic biosynthesis. (J Biol Chem. , 2010)
[23832247] JadR and jadR2 act synergistically to repress jadomycin biosynthesis. (Sci China Life Sci. , 2013)
[25116816] A gamma-butyrolactone-sensing activator/repressor, JadR3, controls a regulatory mini-network for jadomycin biosynthesis. (Mol Microbiol. , 2014)

close this sectionSequence

selected fasta
>transcriptional regulator [JadR1]
MSLTSVEVKEPHIPAPRLAGRASLSGVSVDTSARGGPVTAAGWRVLVVESCGKEGEGLVQ
GLRRHGHEVDRVETGGAALQAYEEADLVLIDLELPDLDGLEVCRGIRSAGDVPVIAVTSR
GSELDRVLGLQAGADDYLVKPYGFRELMARMEAVMRRARPRPSTARTITRGPLHIDAAAR
QVTLDGQDVDLTRKEFDLLYLLASHPDTVIPRKQLMQQVWGDSWSRRTVDTHVSSLRNKL
GASDWVITIRGVGFRFGRG
selected fasta
>transcriptional regulator [JadR1]
GTGAGCCTGACGTCCGTAGAAGTGAAGGAGCCCCACATACCTGCCCCACGACTCGCCGGG
AGAGCGAGTCTGTCGGGCGTGAGCGTGGACACATCGGCGAGGGGCGGCCCGGTCACCGCG
GCCGGCTGGCGCGTCCTGGTCGTGGAGAGCTGCGGCAAGGAGGGGGAGGGGCTCGTACAG
GGGCTCCGCCGGCACGGCCACGAGGTCGACCGGGTGGAGACGGGGGGCGCCGCCCTCCAG
GCCTACGAAGAGGCCGACTTGGTCCTGATCGACCTCGAACTGCCCGACCTGGACGGCTTG
GAGGTCTGCCGCGGCATCCGGTCCGCCGGGGACGTGCCGGTGATCGCCGTGACGAGCCGC
GGCAGCGAACTCGACCGCGTCCTCGGCCTCCAGGCCGGCGCGGACGACTACCTGGTGAAG
CCCTACGGCTTCCGTGAACTGATGGCCCGGATGGAGGCCGTCATGCGCCGGGCCCGGCCC
CGGCCCTCCACCGCCCGCACGATCACCCGCGGACCGCTGCACATCGACGCGGCCGCCCGG
CAGGTCACGCTCGACGGCCAGGACGTCGACCTGACCCGCAAGGAGTTCGACCTCCTCTAT
CTGCTCGCCTCCCACCCCGACACGGTCATCCCGCGCAAGCAGTTGATGCAGCAGGTGTGG
GGGGACTCCTGGTCGAGGCGGACCGTCGACACCCATGTGAGCAGCCTGCGCAACAAGCTC
GGCGCCAGCGACTGGGTGATCACCATCCGAGGCGTGGGTTTCCGCTTCGGCCGCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [43-151]  1.7e-33 SM00448
SM00448   cheY-homologous receiver domain
 [44-155]  32.243 PS50110
PS50110   RESPONSE_REGULATORY
 [55-151]  5.9e-20 PF00072
PF00072   Response_reg
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [186-256]  1.4e-22 PF00486
PF00486   Trans_reg_C
 [186-256]  5.4e-25 SM00862
SM00862   Transcriptional regulatory protein, C ter
IPR011006 CheY-like superfamily (Domain)
 [40-228]  4.6e-34 SSF52172
SSF52172   CheY-like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [165-256]  3.3e-27 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
SignalP
 [1-33]  0.29 Signal
Bacteria, Gram-positive   
TMHMM No significant hit