close all open/close all

CDS information : Jado_00060


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction6,401 / 8,155 / + [in whole cluster]
153 / 1,907 / + [in contig]
Location6401..8155 [in whole cluster]
153..1907 [in contig]
TypeCDS
Length1,755 bp (584 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acyl-CoA carboxylase alpha subunit
Product (GenBank)JadJ
Gene
Gene (GenBank)jadJ
EC number6.4.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10784049] An acyl-coenzyme A carboxylase encoding gene associated with jadomycin biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 2000)
Related Reference
ACC
Q9X4K6
PmId
[10589718] Genetic and biochemical characterization of the alpha and beta components of a propionyl-CoA carboxylase complex of Streptomyces coelicolor A3(2). (Microbiology. , 1999)
ACC
Q9RGQ6
PmId
[10589718] Genetic and biochemical characterization of the alpha and beta components of a propionyl-CoA carboxylase complex of Streptomyces coelicolor A3(2). (Microbiology. , 1999)

close this sectionSequence

selected fasta
>putative acyl-CoA carboxylase alpha subunit [JadJ]
MRKVLIANRGEIAVRVARACRDAGIGSVAVYAEPDRDALHVRAADEAFALGGDTPATSYL
DMAKVLQAAADSGADAVHPGYGFLSENAEFAQAVLDAGLTWIGPPPQAIRDLGDKVAARH
IAQRAGAPLVAGTPDPVSGADEVVAFAEEHGLPIAIKAAFGGGGRGLKVARTLEEVPELY
DSAVREAVAAFGRGECFVERYLDKPRHVETQCLADQHGNVVVVSTRDCSLQRRHQKLVEE
APAPFLSEAQNAELYAASKAILKEAGYVGAGTVEFLVGTDGTISFLEVNTRLQVEHPVTE
EVTGIDLVREMFRIADGEELGYGDPEIRGHSFEFRINGEDPGRGFLPAPGTVTEFTPPTG
PGVRLDAGVESGSVIGPAWDSLLANVIVTGASREQALQRAARAVAEFRVEGMATAIPFHQ
AVVTDPDFTADPFRVHTRWIETEFVNEIKPFAPAGEADEDEAGRETIVVEVGGKRLEVSL
PSSLGMTLARTVLRRVPKPKRRASKKVRASAASGDTLASPMQGTIVKVAVEEGQEVKEGD
LIVVLEAMKMEQPLNAHRSGTVKGLTAEVGASVTSGATICDIKD
selected fasta
>putative acyl-CoA carboxylase alpha subunit [JadJ]
GTGCGCAAGGTGCTCATCGCCAACCGTGGCGAAATCGCTGTCCGTGTGGCCCGGGCGTGC
CGGGACGCGGGTATCGGCAGCGTGGCCGTGTACGCCGAGCCGGACCGGGATGCTCTGCAT
GTCCGGGCGGCTGACGAGGCGTTCGCTCTGGGCGGTGACACTCCGGCGACCAGTTATCTG
GACATGGCGAAGGTGTTGCAGGCCGCCGCGGACTCGGGTGCGGACGCGGTCCACCCCGGT
TACGGGTTCCTTTCGGAGAACGCGGAGTTCGCGCAGGCGGTCCTCGACGCGGGTCTGACG
TGGATCGGTCCGCCGCCGCAGGCGATCCGGGATCTGGGTGACAAGGTGGCGGCCCGTCAC
ATCGCCCAGCGTGCCGGGGCCCCGCTGGTGGCCGGCACGCCCGACCCGGTCTCGGGTGCG
GACGAGGTCGTGGCGTTCGCCGAGGAGCACGGTCTGCCGATCGCGATCAAGGCGGCGTTC
GGTGGCGGTGGCCGTGGTCTGAAGGTGGCGCGGACGCTGGAGGAGGTCCCGGAGCTGTAC
GACTCCGCGGTCCGTGAGGCGGTGGCGGCGTTCGGGCGGGGCGAGTGCTTCGTGGAGCGG
TACCTGGACAAGCCGCGGCACGTGGAGACGCAGTGCCTGGCCGACCAGCACGGCAACGTG
GTCGTCGTCTCGACGCGTGACTGCTCGCTGCAGCGCCGTCACCAGAAGCTGGTGGAGGAG
GCTCCGGCGCCGTTCCTGTCGGAGGCTCAGAACGCGGAGCTGTACGCGGCGTCGAAGGCG
ATCCTGAAGGAGGCCGGTTACGTCGGTGCCGGCACGGTGGAGTTCCTCGTCGGCACGGAC
GGCACGATCTCGTTCCTCGAGGTCAACACCCGTCTGCAGGTGGAGCACCCGGTGACGGAG
GAGGTCACGGGGATCGACCTGGTGCGGGAGATGTTCCGGATCGCGGACGGTGAGGAGCTC
GGCTACGGCGACCCGGAGATCCGGGGTCACTCCTTCGAGTTCCGGATCAACGGTGAGGAC
CCGGGCCGTGGTTTCCTCCCGGCGCCCGGCACCGTCACCGAGTTCACGCCGCCGACCGGT
CCGGGTGTCCGCCTCGACGCGGGTGTGGAGTCGGGTTCCGTGATCGGCCCCGCGTGGGAC
TCGCTGCTTGCGAACGTGATCGTGACCGGTGCGAGCCGTGAGCAGGCGCTGCAGCGTGCG
GCGCGTGCCGTGGCGGAGTTCCGCGTCGAGGGCATGGCGACCGCGATCCCCTTCCACCAG
GCGGTGGTGACCGACCCGGACTTCACCGCGGACCCGTTCCGGGTGCACACGCGGTGGATC
GAGACGGAGTTCGTCAACGAGATCAAGCCGTTCGCGCCGGCGGGGGAGGCGGACGAGGAC
GAGGCCGGCCGCGAGACGATCGTGGTCGAGGTCGGCGGCAAGCGTCTTGAGGTCTCCCTG
CCGTCCTCGCTCGGGATGACGCTGGCCCGGACGGTCTTGCGGCGGGTGCCGAAGCCGAAG
CGGCGGGCGTCGAAGAAGGTCCGGGCTTCGGCCGCCTCGGGTGACACCCTCGCCTCCCCG
ATGCAGGGCACGATCGTGAAGGTCGCGGTCGAGGAGGGCCAGGAGGTCAAGGAAGGCGAT
CTGATCGTCGTCCTGGAGGCCATGAAGATGGAACAGCCCCTCAACGCCCACCGCTCCGGC
ACCGTGAAGGGCCTGACCGCCGAAGTCGGCGCGTCCGTCACCTCCGGCGCCACCATCTGC
GACATCAAGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000089 Biotin/lipoyl attachment (Domain)
 [515-582]  PS50968
PS50968   BIOTINYL_LIPOYL
 [517-582]  5.69999999999998e-17 PF00364
PF00364   Biotin_lipoyl
IPR001882 Biotin-binding site (Binding_site)
 [539-556]  PS00188
PS00188   BIOTIN
IPR005479 Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domain (Domain)
 [285-292]  PS00867
PS00867   CPSASE_2
 [114-320]  2.90000000000003e-75 PF02786
PF02786   CPSase_L_D2
IPR005481 Carbamoyl-phosphate synthase, large subunit, N-terminal (Domain)
 [2-109]  1.40000000000001e-40 PF00289
PF00289   CPSase_L_chain
IPR005482 Biotin carboxylase, C-terminal (Domain)
 [333-441]  6.29999999999998e-34 PF02785
PF02785   Biotin_carb_C
 [333-441]  9.10000425645573e-54 SM00878
SM00878   Biotin_carb_C
IPR011053 Single hybrid motif (Domain)
 [500-583]  2.60000517657733e-20 SSF51230
SSF51230   Hybrid_motif
IPR011054 Rudiment single hybrid motif (Domain)
 [328-444]  1.40000506907309e-38 SSF51246
SSF51246   Rudmnt_hyb_motif
IPR011761 ATP-grasp fold (Domain)
 [119-316]  PS50975
PS50975   ATP_GRASP
IPR011764 Biotin carboxylation domain (Domain)
 [1-443]  PS50979
PS50979   BC
IPR013815 ATP-grasp fold, subdomain 1 (Domain)
 [129-201]  6.3e-21 G3DSA:3.30.1490.20
G3DSA:3.30.1490.20   ATP_grasp_subdomain_1
IPR013816 ATP-grasp fold, subdomain 2 (Domain)
 [203-444]  1.29999999999998e-87 G3DSA:3.30.470.20
G3DSA:3.30.470.20   ATP_grasp_subdomain_2
IPR016185 Pre-ATP-grasp fold (Domain)
 [1-112]  8.59998776239544e-47 SSF52440
SSF52440   PreATP-grasp-like
 [2-128]  7.5e-48 G3DSA:3.40.50.20
G3DSA:3.40.50.20   Pre-ATP_grasp
SignalP No significant hit
TMHMM No significant hit