close all open/close all

CDS information : Jado_00070


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction8,268 / 8,597 / + [in whole cluster]
2,020 / 2,349 / + [in contig]
Location8268..8597 [in whole cluster]
2020..2349 [in contig]
TypeCDS
Length330 bp (109 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)jadomycin polyketide synthase cyclase
Gene
Gene (GenBank)jadI
EC number
Keyword
  • angucycline
Note
Note (GenBank)
  • JadI
Reference
ACC
PmId
[11520231] Production of aromatic minimal polyketides by the daunorubicin polyketide synthase genes reveals the incompatibility of the heterologous DpsY and JadI cyclases. (J Nat Prod. , 2001)
Related Reference
ACC
Q93LY5
PmId
[12654660] Engineering anthracycline biosynthesis toward angucyclines. (Antimicrob Agents Chemother. , 2003)

close this sectionSequence

selected fasta
>putative cyclase [jadomycin polyketide synthase cyclase]
MHSTLIVARMEPGSSTDVAKLFAEFDASEMPHLMGTRRRQLFSYRGLYFHLQDFDADNGG
ELIERAKTDPRFVGISEDLKPFIEAYDPATWRSPADAMATRFYNWEANA
selected fasta
>putative cyclase [jadomycin polyketide synthase cyclase]
ATGCACAGCACTCTGATCGTGGCCCGAATGGAACCCGGATCGAGCACCGACGTGGCGAAG
CTGTTCGCCGAATTCGACGCCTCCGAGATGCCGCATCTCATGGGGACGCGACGCCGTCAG
CTGTTCTCGTACCGCGGCCTCTACTTCCACCTCCAGGACTTCGACGCCGACAACGGCGGC
GAGCTCATCGAGCGGGCCAAGACCGACCCCCGCTTCGTGGGCATCAGCGAGGACCTGAAG
CCGTTCATCGAGGCCTACGACCCGGCCACCTGGCGCTCGCCCGCCGACGCCATGGCCACC
CGCTTCTACAACTGGGAGGCGAACGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006765 Polyketide synthesis cyclase (Family)
 [1-108]  7.1e-50 G3DSA:3.30.70.1090
G3DSA:3.30.70.1090   no description
 [2-107]  3e-58 PD012644
PD012644   Q9XCV6_9ACTO_Q9XCV6;
 [10-107]  3.9e-43 PF04673
PF04673   Cyclase_polyket
IPR011008 Dimeric alpha-beta barrel (Domain)
 [1-108]  3e-46 SSF54909
SSF54909   Dimeric alpha+beta barrel
SignalP No significant hit
TMHMM No significant hit