close all open/close all

CDS information : Jado_00100


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction11,116 / 11,385 / + [in whole cluster]
4,868 / 5,137 / + [in contig]
Location11116..11385 [in whole cluster]
4868..5137 [in contig]
TypeCDS
Length270 bp (89 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)acyl carrier protein
GenejadC
Gene (GenBank)acp
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionPKS/NRPS Module

ACP7..80

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [acyl carrier protein]
MSSKTFTLDDLKRILREGAGADEGVDLDGDILDTHFETLGYESLALLETGSRIEREYSIT
LDDDVLSDADTPRALIEAVNAHLSAVAAA
selected fasta
>polyketide synthase acyl carrier protein subunit [acyl carrier protein]
ATGAGCAGCAAGACCTTCACCCTCGACGACCTCAAGCGGATCCTGCGCGAGGGCGCCGGC
GCCGACGAGGGCGTCGACCTCGACGGCGACATCCTCGACACCCACTTCGAGACGCTCGGC
TACGAGTCGCTCGCCCTGCTGGAGACCGGCAGCCGCATCGAGCGCGAGTACTCCATCACC
CTCGACGACGACGTGCTGTCCGACGCCGACACCCCGCGCGCCCTCATCGAGGCCGTCAAC
GCGCACCTGTCGGCCGTCGCCGCCGCCTGA
ACP7..80
ACP19..240

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [38-53]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [3-83]  1.8e-14 SSF47336
SSF47336   ACP-like
 [5-84]  1.9e-15 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [11-79]  4.4e-08 PF00550
PF00550   PP-binding
 [7-80]  15.439 PS50075
PS50075   ACP_DOMAIN
SignalP
 [1-21]  0.054 Signal
Eukaryota   
TMHMM No significant hit