close all open/close all

CDS information : Jado_00110


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction11,459 / 12,253 / + [in whole cluster]
5,211 / 6,005 / + [in contig]
Location11459..12253 [in whole cluster]
5211..6005 [in contig]
TypeCDS
Length795 bp (264 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productpolyketide C-9 ketoreductase
Product (GenBank)ketoreductase
GenejadE
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>polyketide C-9 ketoreductase [ketoreductase]
MSQQEKQEKRVALVTGATSGIGLAVARLLASQNHRVFLGARNAENVAATVKQLQDEGLEV
DGTTLDVRSGEDVKAFVQAAVDRFGTVELLVNNAGRSGAGVTADIADELWNDVIDTNLNC
VFRLTREALTTGGMREKSRGRIINMASTAGKQGVVLGAPYSASKHGVVGFTKALGNELAP
TGITVNAVCPGYVETPMAQRVRQGYAAAYETSEDAILEKFQSKIPLGRYSTPEEVAGLVG
YLASDTAASITSQALNVCGGLGNF
selected fasta
>polyketide C-9 ketoreductase [ketoreductase]
ATGTCCCAGCAGGAGAAGCAGGAGAAGAGGGTCGCCCTCGTCACCGGAGCCACCAGTGGC
ATCGGCCTCGCCGTCGCCCGGCTCCTGGCGTCCCAGAACCACCGGGTGTTCCTCGGTGCC
CGCAACGCCGAGAACGTCGCCGCCACCGTCAAGCAGCTCCAGGACGAGGGCCTTGAGGTC
GACGGCACCACCCTCGACGTGCGCTCCGGCGAGGACGTCAAGGCCTTCGTCCAGGCCGCC
GTCGACCGCTTCGGCACCGTCGAGCTCCTCGTGAACAACGCGGGCCGCAGCGGCGCGGGC
GTCACCGCCGACATCGCCGACGAGCTGTGGAACGACGTCATCGACACCAACCTCAACTGC
GTCTTCCGGCTCACCCGCGAGGCCCTGACCACCGGCGGCATGCGCGAGAAGTCCCGCGGC
CGGATCATCAACATGGCCTCGACCGCCGGCAAGCAGGGCGTCGTCCTCGGCGCCCCCTAC
TCGGCCTCGAAGCACGGCGTCGTCGGCTTCACCAAGGCCCTCGGCAACGAGCTCGCCCCG
ACCGGCATCACCGTCAACGCGGTCTGCCCCGGTTACGTCGAGACGCCGATGGCCCAGCGC
GTCCGCCAGGGCTACGCCGCCGCGTACGAGACCTCCGAGGACGCCATCCTCGAGAAGTTC
CAGTCGAAGATCCCGCTCGGCCGCTACTCCACGCCCGAGGAGGTCGCCGGTCTCGTCGGC
TACCTGGCCTCCGACACCGCGGCCTCCATCACCTCGCAGGCGCTCAACGTCTGCGGCGGC
CTGGGCAACTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [85-96]  1.69999922284049e-13 PR00080 [140-148]  1.69999922284049e-13 PR00080 [160-179]  1.69999922284049e-13 PR00080
PR00080   SDRFAMILY
 [1-256]  5.09999882439978e-16 PIRSF000126
PIRSF000126   11-beta-HSD1
 [11-178]  3.60000000000002e-34 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [11-28]  9.19998414420354e-50 PR00081 [85-96]  9.19998414420354e-50 PR00081 [134-150]  9.19998414420354e-50 PR00081 [160-179]  9.19998414420354e-50 PR00081 [181-198]  9.19998414420354e-50 PR00081 [225-245]  9.19998414420354e-50 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [4-261]  5.09999999999993e-81 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [147-175]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-30]  0.857 Signal
Bacteria, Gram-positive   
 [1-26]  0.505 Signal
Bacteria, Gram-negative   
TMHMM
 [12-31]  Transmembrane (i-o)
Transmembrane 1