close all open/close all

CDS information : Jado_00120


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction12,294 / 13,226 / + [in whole cluster]
6,046 / 6,978 / + [in contig]
Location12294..13226 [in whole cluster]
6046..6978 [in contig]
TypeCDS
Length933 bp (310 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase/dehydratase
Product (GenBank)bifunctional cyclase/dehydrase
GenejadD
Gene (GenBank)
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
Reference
ACC
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>cyclase/dehydratase [bifunctional cyclase/dehydrase]
MTTREVEHEITVAAPAQAVYRLIAEVENWPRIFPPTLYVDHVERGEREERIRIWATANGA
PKNWTSKRTLDPDNLRITFRQEVSTPPVAAMATWIIEPVSATESGSALLHDYRAIDDDPE
GLKWVDEAVDRNSRSELAALKTNVELAHASEEITFSFEDTVQIDGSAKDAYDFVNEANLW
PERLPHVATVRFEEETPGLQSLEMDSRAKDGSTHTTKSYRVTFPHHRIAYKQITLPALMT
LHTGYWTFEENEDGVAASSQHTVVLNTENIARILGADATVADAREYVQTALSTNSRATLG
YAKAYAEGKR
selected fasta
>cyclase/dehydratase [bifunctional cyclase/dehydrase]
ATGACGACCCGTGAGGTCGAGCACGAGATCACCGTCGCGGCCCCGGCCCAGGCCGTGTAC
CGGCTGATCGCCGAGGTGGAGAACTGGCCGCGGATCTTCCCGCCCACCCTCTACGTCGAC
CACGTCGAGCGCGGCGAGCGGGAGGAGCGCATCCGGATCTGGGCGACCGCCAACGGCGCC
CCGAAGAACTGGACGTCCAAGCGGACCCTGGACCCGGACAACCTCCGGATCACCTTCCGC
CAGGAGGTCTCCACCCCGCCGGTCGCCGCCATGGCGACCTGGATCATCGAGCCGGTCTCC
GCGACCGAGTCCGGATCCGCCTTGCTGCACGACTACCGGGCGATCGACGACGACCCCGAG
GGCCTGAAGTGGGTCGACGAGGCCGTCGACCGCAACTCGCGCTCCGAGCTCGCCGCCCTC
AAGACCAACGTCGAACTCGCCCACGCCTCCGAGGAGATCACCTTCTCCTTCGAGGACACC
GTGCAGATCGACGGCTCCGCCAAGGACGCCTACGACTTCGTCAACGAGGCGAACCTCTGG
CCGGAGCGGCTGCCGCACGTCGCCACCGTGCGCTTCGAGGAGGAGACCCCGGGCCTGCAG
AGCCTGGAGATGGACTCCCGGGCCAAGGACGGCTCCACCCACACGACGAAGTCGTACCGG
GTGACCTTCCCGCACCACCGGATCGCCTACAAGCAGATCACCCTGCCGGCGCTCATGACC
CTGCACACCGGCTACTGGACGTTCGAGGAGAACGAGGACGGCGTCGCCGCCTCCTCGCAG
CACACGGTCGTCCTCAACACCGAGAACATCGCCCGGATCCTCGGCGCCGACGCCACCGTC
GCCGACGCCCGCGAGTACGTGCAGACGGCGCTCAGCACCAACAGCCGGGCCACCCTCGGG
TACGCCAAGGCCTACGCCGAGGGCAAGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [5-145]  2.3e-11 PF10604 [155-286]  7.4e-07 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [5-82]  1.2e-14 G3DSA:3.30.530.20 [157-256]  1.2e-14 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit