close all open/close all

CDS information : Jado_00140


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction14,875 / 15,552 / + [in whole cluster]
1,563 / 2,240 / + [in contig]
Location14875..15552 [in whole cluster]
1563..2240 [in contig]
TypeCDS
Length678 bp (225 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productdehydrorabelomycin C-5 hydroxylase/Baeyer-Villiger monooxygenase/decarboxylase
Product (GenBank)JadG
Gene
Gene (GenBank)jadG
EC number
Keyword
  • ring opening
Note
  • multifunctional protein
Note (GenBank)
  • anthrone monooxygenase
Reference
ACC
PmId
[15817470] Functional analyses of oxygenases in jadomycin biosynthesis and identification of JadH as a bifunctional oxygenase/dehydrase. (J Biol Chem. , 2005)
[15776503] The oxidative ring cleavage in jadomycin biosynthesis: a multistep oxygenation cascade in a biosynthetic black box. (Chembiochem. , 2005)
[22465094] Delineation of gilvocarcin, jadomycin, and landomycin pathways through combinatorial biosynthetic enzymology. (Curr Opin Chem Biol. , 2012)
[23177193] Identification of JadG as the B ring opening oxygenase catalyzing the oxidative C-C bond cleavage reaction in jadomycin biosynthesis. (Chem Biol. , 2012)
[23102024] Baeyer-Villiger C-C bond cleavage reaction in gilvocarcin and jadomycin biosynthesis. (J Am Chem Soc. , 2012)
Related Reference
ACC
Q7X2G5
NITE
Gilvo_00090
PmId
[17346045] Multi-oxygenase complexes of the gilvocarcin and jadomycin biosyntheses. (J Am Chem Soc. , 2007)
[22465094] Delineation of gilvocarcin, jadomycin, and landomycin pathways through combinatorial biosynthetic enzymology. (Curr Opin Chem Biol. , 2012)
[23102024] Baeyer-Villiger C-C bond cleavage reaction in gilvocarcin and jadomycin biosynthesis. (J Am Chem Soc. , 2012)

close this sectionSequence

selected fasta
>dehydrorabelomycin C-5 hydroxylase/Baeyer-Villiger monooxygenase/decarboxylase [JadG]
MPLINPEDGYLTVFNLFETETYDGQARVVDEMKDIVDNATYPGWISSTVHAGVDTPGTLN
YIQWRSLADLEARYQGQKFQKKTVPLFDQLATSVKLLKTELVHAQHHPDLGAAAEVSPER
DDYAVFILFEVKPDQQQELLDTLAKPDEWIKTVPGYRSHGYYRGIDGTYVVNYAQWESKE
LYEAFHTLPEEQRPADIREGRLRARSLVTSRWANSFRAVHSRSAE
selected fasta
>dehydrorabelomycin C-5 hydroxylase/Baeyer-Villiger monooxygenase/decarboxylase [JadG]
ATGCCTCTGATCAACCCCGAAGACGGCTACCTGACCGTCTTCAACCTCTTCGAGACCGAG
ACCTACGACGGTCAGGCCCGCGTCGTCGACGAGATGAAGGACATCGTCGACAACGCCACG
TACCCCGGCTGGATCTCCTCCACCGTGCACGCCGGCGTCGACACCCCGGGCACCCTCAAC
TACATCCAGTGGCGCAGCCTCGCCGACCTGGAGGCGCGCTACCAGGGGCAGAAGTTCCAG
AAGAAGACCGTGCCGCTCTTCGACCAGCTCGCCACCTCCGTGAAGCTGCTCAAGACGGAG
CTCGTGCACGCCCAGCACCACCCCGACCTGGGCGCCGCCGCCGAGGTCTCGCCCGAGCGC
GACGACTACGCCGTCTTCATCCTCTTCGAGGTGAAGCCGGACCAGCAGCAGGAGCTCCTG
GACACCCTCGCCAAGCCCGACGAGTGGATCAAGACCGTCCCGGGCTACCGCTCGCACGGC
TACTACCGCGGCATCGACGGCACGTACGTCGTCAACTACGCCCAGTGGGAGAGCAAGGAG
CTCTACGAGGCCTTCCACACCCTGCCCGAGGAGCAGCGCCCCGCCGACATCCGCGAGGGC
CGGCTGCGCGCCCGCTCCCTCGTCACCTCCCGCTGGGCCAACTCCTTCCGCGCGGTCCAC
TCGCGCTCGGCGGAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [23-81]  3e-05 PF03992 [124-190]  5.5e-11 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [1-108]  3.2e-19 SSF54909 [113-219]  4.7e-20 SSF54909
SSF54909   Dimeric alpha+beta barrel
SignalP
 [1-26]  0.081 Signal
Eukaryota   
TMHMM No significant hit