close all open/close all

CDS information : Jado_00150


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction15,558 / 17,183 / + [in whole cluster]
2,246 / 3,871 / + [in contig]
Location15558..17183 [in whole cluster]
2246..3871 [in contig]
TypeCDS
Length1,626 bp (541 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Product4a,12b-dehydratase/C-12 hydroxylase
Product (GenBank)JadH
Gene
Gene (GenBank)jadH
EC number
Keyword
Note
  • bifunctional protein
  • This gene product have been proved to have C-12b hydroxylase activity, though the activity would not be demonstrated in jadomycin biosynthesis.
Note (GenBank)
  • bifunctional monooxygenase-dehydratase
Reference
ACC
PmId
[15817470] Functional analyses of oxygenases in jadomycin biosynthesis and identification of JadH as a bifunctional oxygenase/dehydrase. (J Biol Chem. , 2005)
[15776503] The oxidative ring cleavage in jadomycin biosynthesis: a multistep oxygenation cascade in a biosynthetic black box. (Chembiochem. , 2005)
[17346045] Multi-oxygenase complexes of the gilvocarcin and jadomycin biosyntheses. (J Am Chem Soc. , 2007)
[20422670] Characterization of JadH as an FAD- and NAD(P)H-dependent bifunctional hydroxylase/dehydrase in jadomycin biosynthesis. (Chembiochem. , 2010)
[22633416] Tailoring enzymes involved in the biosynthesis of angucyclines contain latent context-dependent catalytic activities. (Chem Biol. , 2012)

close this sectionSequence

selected fasta
>4a,12b-dehydratase/C-12 hydroxylase [JadH]
MTTTPEAGFDADVIVVGAGPTGLMLAGERRLGGARVLVAERLERPTGQSRGLGFTARAME
VFDQRGLLPRFGQGETLETSPMGHFGGVQFDYTVLEGAHFGARGIPQYTTESVLEEWATE
LGADIRRGWEFTGLDQDDDAVEITVRTPEGERRLRAAYVVGCDGGHSPVRKAAGFDFPGT
PATREMYLADVVGCGLKPRFLGERLPEGMVMAAPLAEGVDRIIVCPHGTPPRDRRDAQAV
SFAEVAAAWQRITGEDISGGSAEWVSSFTDTTRQATEYRRGRVLLVGDAAHIHLPAGGQG
LSTGVQDAANLGWKLAAVVRGTAPDGLLDTYHGERHPVGQRLLMNTRAQGTVFLGGEESD
PLRELFTELLAYDDVKRHLAGVVSGLDIRYDLAGGADDPLVGARLAHRALTTAAGETSTT
RLVHAGQGVLLDLADDPAVRDAAAAWKDRVVTVTGTPLPVEGTDVLAGVTAVLVRPDGHV
AWTARAAGADASDAGTEAGAAASLAGTDAEGLGASLRRWFGEPASDASVTPGASADGGAA
R
selected fasta
>4a,12b-dehydratase/C-12 hydroxylase [JadH]
GTGACCACCACCCCGGAAGCCGGCTTCGACGCCGACGTGATCGTCGTCGGCGCGGGTCCC
ACCGGTCTGATGCTCGCCGGTGAACGGCGCCTCGGCGGCGCCCGGGTGCTCGTCGCCGAG
CGCCTTGAGCGGCCCACCGGCCAGTCCCGCGGGCTCGGCTTCACGGCCCGCGCCATGGAG
GTCTTCGACCAGCGCGGACTGCTGCCGCGCTTCGGCCAGGGGGAGACCCTGGAGACCAGC
CCGATGGGCCACTTCGGCGGTGTGCAGTTCGACTACACCGTCCTGGAGGGCGCCCACTTC
GGCGCCCGCGGCATCCCCCAGTACACGACCGAGTCGGTCCTGGAGGAGTGGGCCACCGAG
CTCGGCGCGGACATCCGGCGCGGCTGGGAGTTCACCGGCCTCGACCAGGACGACGACGCC
GTGGAGATCACCGTCCGCACCCCCGAGGGGGAGCGGCGGCTGCGCGCGGCCTACGTCGTC
GGCTGCGACGGCGGCCACAGCCCCGTGCGCAAGGCGGCCGGCTTCGACTTCCCCGGCACC
CCCGCCACCCGCGAGATGTACCTCGCGGACGTCGTCGGCTGCGGGCTGAAGCCCCGGTTC
CTCGGCGAGCGGCTGCCGGAGGGCATGGTCATGGCGGCGCCGCTCGCCGAGGGCGTCGAC
CGGATCATCGTCTGCCCGCACGGCACCCCGCCGCGCGACCGCAGGGACGCCCAGGCCGTC
AGCTTCGCCGAGGTGGCCGCCGCCTGGCAGCGCATCACGGGCGAGGACATCAGCGGCGGT
TCGGCCGAGTGGGTCAGCTCCTTCACCGACACCACCCGGCAGGCCACCGAGTACCGGCGC
GGCCGGGTGCTGCTGGTGGGCGACGCCGCCCACATCCACCTCCCGGCCGGCGGCCAGGGG
CTGAGCACCGGGGTCCAGGACGCGGCCAACCTCGGCTGGAAGCTGGCCGCCGTGGTCCGC
GGCACGGCGCCCGACGGGCTGCTCGACACCTACCACGGCGAACGCCACCCGGTGGGGCAG
CGCCTGCTGATGAACACCCGGGCCCAGGGCACCGTGTTCCTCGGCGGCGAGGAGTCGGAC
CCGCTGCGCGAGCTGTTCACCGAACTCCTCGCGTACGACGACGTGAAGCGGCACCTCGCC
GGAGTCGTCAGCGGTCTCGACATCCGCTACGACCTGGCAGGCGGCGCCGACGACCCGCTG
GTCGGGGCGCGGCTCGCGCACCGGGCGCTCACCACGGCGGCGGGGGAGACCAGCACGACC
CGGCTCGTCCACGCCGGGCAGGGCGTGCTGCTCGACCTCGCCGACGACCCGGCGGTCCGG
GACGCCGCGGCGGCCTGGAAGGACCGGGTGGTCACGGTGACGGGCACCCCGCTGCCCGTC
GAGGGCACGGACGTGCTCGCGGGCGTCACGGCCGTCCTGGTCCGGCCCGACGGCCACGTG
GCGTGGACCGCGCGGGCCGCCGGCGCGGACGCGTCGGACGCCGGCACGGAGGCCGGTGCG
GCCGCCTCCCTGGCCGGTACGGACGCCGAGGGCCTGGGCGCGAGCCTGCGCCGCTGGTTC
GGCGAGCCCGCGTCCGACGCGTCCGTCACCCCGGGCGCCTCCGCCGACGGCGGCGCGGCC
CGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [11-345]  1.99999999999999e-82 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [12-34]  2.90000354677981e-43 PR00420 [155-170]  2.90000354677981e-43 PR00420 [280-295]  2.90000354677981e-43 PR00420 [295-311]  2.90000354677981e-43 PR00420 [313-331]  2.90000354677981e-43 PR00420 [331-347]  2.90000354677981e-43 PR00420
PR00420   RNGMNOXGNASE
SignalP No significant hit
TMHMM No significant hit